Typing tool

Complete norovirus genomes

X86557  GII.4 Sydney
 GII.P12

Length: 7,555 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       X86557                  7555 bp    RNA     linear   VRL 18-APR-2005
DEFINITION  Lordsdale virus complete genome.
ACCESSION   X86557
VERSION     X86557.1
KEYWORDS    capsid protein; complete genome; polyprotein.
SOURCE      Lordsdale virus
  ORGANISM  Lordsdale virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7555)
  AUTHORS   Liu,B.L., Clarke,I.N., Caul,E.O. and Lambden,P.R.
  TITLE     Human enteric caliciviruses have a unique genome structure and are
            distinct from the Norwalk-like viruses
  JOURNAL   Arch. Virol. 140 (8), 1345-1356 (1995)
   PUBMED   7661689
REFERENCE   2
  AUTHORS   Dingle,K.E., Lambden,P.R., Caul,E.O. and Clarke,I.N.
  TITLE     Human enteric Caliciviridae: the complete genome sequence and
            expression of virus-like particles from a genetic group II small
            round structured virus
  JOURNAL   J. Gen. Virol. 76 (PT 9), 2349-2355 (1995)
   PUBMED   7561776
REFERENCE   3  (bases 1 to 7555)
  AUTHORS   Dingle,K.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-APR-1995) K.E. Dingle, University of Southampton
            Medical School, Dept. of Molecular Microbiology, Southampton
            General Hospital, Southampton, SO16 6YD, UK
FEATURES             Location/Qualifiers
     source          1..7555
                     /organism="Lordsdale virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:82658"
     gene            5..5104
                     /gene="orf1"
     CDS             5..5104
                     /gene="orf1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="CAA60254.1"
                     /db_xref="GOA:P54634"
                     /db_xref="InterPro:IPR000605"
                     /db_xref="InterPro:IPR001205"
                     /db_xref="InterPro:IPR001665"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007094"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR013614"
                     /db_xref="InterPro:IPR014759"
                     /db_xref="UniProtKB/Swiss-Prot:P54634"
                     /translation="MKMASNDASAAAVVNSNNDTAKSSSDGVLSSMAVTFKRALGGRA
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSVKDGVSGLPELSTVRQPD
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANVFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRLRPVVVMISGKPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKRCQIVYSGCTYTLESDGKGNVKVDRVQSATVQTNHELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEDTANKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLDFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPVKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKRTIINVLEQTIDPPQKWSFTQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDINLNPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6704
                     /gene="orf2"
     CDS             5085..6704
                     /gene="orf2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="CAA60255.1"
                     /db_xref="GOA:P54635"
                     /db_xref="InterPro:IPR004005"
                     /db_xref="InterPro:IPR013643"
                     /db_xref="UniProtKB/Swiss-Prot:P54635"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQANDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPVLTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTHIAGSHDYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQAGQNTKFTPVGVIQDG
                     DHHQNEPQQWSLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVL
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6704..7510
                     /gene="orf3"
     CDS             6704..7510
                     /gene="orf3"
                     /codon_start=1
                     /protein_id="CAA60256.1"
                     /db_xref="GOA:P54636"
                     /db_xref="InterPro:IPR004278"
                     /db_xref="UniProtKB/Swiss-Prot:P54636"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSTLQQASFQHDKEMLQAQIEATQKLQQDLMKVKQAVLLEGGFSTADAARGAIN
                     APMTKALDWSGTRYWAPDARVTTYNAGHFSTPQSLGALTGRTNSRVSAPARSSPSALS
                     NAPTATSLHSNQTVSTRLGSSAGSGTGVSSLSSAARTRSWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSSQSTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgttaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtact ttctagcatg gctgtcactt ttaaacgagc
      121 cctcgggggg cgggctaaac agcctccccc gagggaaaca ccacaaagac ccccacgacc
      181 acctacccca gaactggtca aaaagatccc ccctcccccg cctaacgggg aggatgaact
      241 agtggtttct tatagtgtca aagatggcgt ttccggtctg cctgagcttt ccactgtcag
      301 gcaaccggat gaagccaaca cggccttcag cgttccccca ctcaaccaga gggagaatag
      361 ggacgccaag gagccactaa ctggaacaat cctggaaatg tgggacggag agatctacca
      421 ttacggtctg tatgtggaac gaggacttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggtcgaac taacaccact ctccttgttc tggaggcctg tatacactcc
      541 ccagtatctc atctccccag acactctcaa gagattgcac ggagaatcgt tcccctatac
      601 agcttttgac aacaattgct atgccttctg ttgttgggtc ttagacctga acgactcgtg
      661 gttgagtagg agaatgatcc agagaacaac tggtttcttc agaccctatc aagattggaa
      721 taggaagccc ctccccacta tggatgattc taaattaaag aaggtagcta acgtattcct
      781 gtgtgctcta tcctcactat tcaccagacc catcaaagac ataataggga agctgagacc
      841 ccttaacatc ctcaacatcc tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttgctaggtg attacgagct gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccaata gtgatggggg gaattggttt ggtgctagga tttaccaaag agaagattgg
     1081 gaagatgttg tcatctgctg catccacctt aagagcttgc aaagatcttg gcgcatacgg
     1141 gctggaaatc ctaaaactag tcatgaagtg gttcttccca aagaaagaag aagcaaatga
     1201 actggctatg gtgagatcca tcgaggacgc ggtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accctgctca aagacaaaga cagtctggca acctacatga gaactcttga
     1321 ccttgaggag gagaaagcca ggaagctttc aaccaagtct gcttcacctg acattgtggg
     1381 cacaatcaac gctctcctgg cgagaattgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac taagacctgt tgttgtgatg atatcaggca aaccagggat
     1501 agggaagacc caccttgcca gggaactggc caagagaatc gcagcctccc tcacagggga
     1561 ccagcgtgta ggtctcatcc cacgcaatgg cgtcgaccac tgggacgcgt acaaggggga
     1621 gagggtcgtt ctgtgggacg attatggaat gagtaacccc atccatgatg ccctcaggtt
     1681 acaagaactc gctgacactt gcccccttac gctgaactgt gacaggatcg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataattat caccaccaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cttgctcgag gcgcattgac ttcttagtct atgcagaagc
     1861 ccctgaagtc gagaaggcga aacgtgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagccct gatttctcgc acataaaact ggcgctggct ccacagggtg gcttcgacaa
     1981 gaatggaaac accccacatg ggaagggcgt catgaagact ctcaccactg gttccctcat
     2041 tgctcgagca tcagggctac tccatgagag gttggacgag tacgagctac agggcccagc
     2101 tctcaccact tttaactttg atcgcaacaa ggtgcttgct tttaggcagc ttgccgctga
     2161 gaacaaatat gggctgatgg acacaatgaa agttggaaga cagctcaagg atgtcagaac
     2221 catgccagag cttaaacaag cactcaagaa tatctcaatc aagaggtgcc agatagtgta
     2281 cagtggttgc acttacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcaaagtgcc accgtacaga ccaaccacga gctggccggt gccctacacc acctgaggtg
     2401 cgccagaatt aggtattacg tcaagtgtgt ccaggaggcc ctgtattcca tcattcaaat
     2461 tgccggagct gcatttgtca ccacacgcat cgttaagcgt atgaacatac aggacctctg
     2521 gtccaagcca caggtggaag acacagagga cactgccaac aaggatgggt gccctaaacc
     2581 caaagatgat gaggagttcg tcgtctcatc cgacgacatc aaaactgagg gcaagaaggg
     2641 gaagaacaag actggccgtg gcaagaaaca cacagccttt tcaagcaaag gtcttagtga
     2701 tgaagagtac gatgagtaca aaaggatcag ggaagaaaga aacggcaagt attccataga
     2761 agagtacctt caggacaggg acaagtacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagaag aagaggccaa gattcggcaa aggattttca ggccaacaag
     2881 gaaacaacgc aaggaagaga gggcctctct tggtctagtc acaggctctg aaatcaggaa
     2941 gagaaaccca gatgatttca agcccaaggg aaagctgtgg gctgatgatg acaggagtgt
     3001 tgactacaat gagaaactcg atttcgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtttc tcccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacaag agttcttcgg ggtccccgtc aagcaaattc agatacacaa
     3181 atcgggcgaa ttctgccgct tgaggttccc aaaaccaatc agaactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac tgtagtcaca ctactcatca agaggtcaac
     3301 tggagagctt atgcctttag cagccagaat gggaacccat gcaaccatga aaatccaagg
     3361 gcgtactgtt ggaggccaaa tgggcatgct tttgacaggg tccaacgcca aaagtatgga
     3421 tctaggcact acaccaggtg actgtggctg tccctacatc tacaagagag aaaatgacta
     3481 cgtggttatt ggggtccaca cggctgccgc tcgcggtgga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ccacacttga aggtggtgac aacaagggaa cctactgtgg
     3601 cgcaccaatc ctaggtccag gaagtgcccc aaaactcagc accaagacta aattctggag
     3661 atcatccaca gcaccgctcc cacctggtac ctatgagcca gcctaccttg gtggtaagga
     3721 ccctagagtc aagggtggcc cctcattgca acaagttatg agggaccagc tgaaaccgtt
     3781 cacagaaccc aggggcaaac caccaaagcc aagtgtgctg gaggctgcca agagaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctcagaaa tggtcattca cgcaagcctg
     3901 cgcgtcactc gacaagacaa cttccagtgg ccatccgcac cacatgcgga agaacgactg
     3961 ctggaacggg gaatccttca caggcaagtt ggcagatcag gcttccaagg ccaacctgat
     4021 gttcgaagag gggaaaaaca tgaccccagt ttacacaggt gcgctcaagg atgagctggt
     4081 caagactgac aaaatttatg gcaagatcaa gaagaggctt ctctggggct cggacttagc
     4141 gaccatgatc cggtgcgctc gagcattcgg aggcttgatg gatgaactca aggcacactg
     4201 tgttacactt cccatcagag ttggcatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gagacactcc agatacaagt atcactatga tgctgactac tctcggtggg attcaacaca
     4321 acaaagggcc gtgttagcag cagccctaga aatcatggtt aaattctccc cagaaccgca
     4381 tttggcccag atagttgcag aagaccttct atctcctagt gtgatggatg tgggtgactt
     4441 caaaatatca atcaatgagg gccttccctc tggtgtgccc tgcacctctc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgaa gttacaaacc tgtcccctga
     4561 catcatacag gctaattccc tcttttcctt ctatggtgat gatgaaattg tcagtacaga
     4621 tataaactta aacccagaga aactaacagc aaagctcaag gaatacgggt tgaaaccaac
     4681 ccgccctgac aaaactgagg gaccccttat tatctctgaa gacctgaacg gcctcacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggttggttt ggaaaactgg atcagagctc
     4801 aatacttagg caaatgtact ggactagagg ccccaatcat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaact aatgtctttg ctgggcgagg ccgcactcca
     4921 cggcccagca ttctacagca aaattagcaa gctagtcatt gcagaactga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagcttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aataatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ctattgcggc acctgtggcg ggccaacaaa
     5221 acgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaacgctcca ggtgagatac tgtggagcgc gcccttgggc cctgatctga
     5341 acccctatct ttctcatttg tccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aagtaatcct cgcggggaat gcgttcaccg ccgggaaagt catatttgca gcagtcccac
     5461 caaactttcc tactgaaggc ttaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag acaattggaa cctgtgttga tccccctacc tgatgttagg aataatttct
     5581 atcattacaa tcaagcaaat gattctaccc tcaagttgat agcaatgttg tacacaccac
     5641 tcagagctaa taatgccggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttt atatttctgg tgccacccac agttgaatca agaactaaac
     5761 cattcactgt cccagtcttg actgttgagg aaatgtctaa ttcaagattc cccattcctt
     5821 tggaaaagct ttacacgggc cctagtagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gtacgactga tggcgtactt ctaggcacta cccagctgtc agctgttaat atctgtaact
     5941 ttagggggga tgttacccat attgcgggta gccatgatta cacaatgaat ttggcatccc
     6001 aaaattggag caattatgac ccaacagaag agatcccagc ccccctagga acgccagact
     6061 ttgtgggaaa gatccaaggc ttgctcaccc agaccacaag agcggacggc tcgacccgtg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac tgacacgaac aatgatttcc aagctggcca aaacacaaaa ttcaccccag
     6241 ttggcgtcat ccaagacggt gatcaccacc agaatgaacc ccaacaatgg tcactcccaa
     6301 attactcagg tagaactggt cacaatgtgc acctggcccc tgctgtcgcc cccactttcc
     6361 ccggtgagca gcttcttttc tttagatcca ccatgccagg gtgtagcggg taccccaaca
     6421 tgaatttgga ttgcttactc ccccaggaat gggtgttgca cttttaccag gaagcagccc
     6481 cagcacaatc cgatgtggca ctgctgagat ttgtgaatcc agatacaggt agggttctgt
     6541 ttgagtgcaa gcttcataaa tcaggctata tcacagtggc ccacaccggc ccgtatgatt
     6601 tggttctccc ccctaatggt tatttcagat ttgattcttg ggtcaaccag ttctacacac
     6661 tcgcccccat gggaaatgga acggggcgca ggcgtgcatt ataatggctg gagctttctt
     6721 tgctggattg gcatctgatg tcctcggctc tggacttggt tctttaatca atgctggagc
     6781 tggagccatc aatcaaaaag ttgaatttga aaataatagg aaattacaac aagcttcctt
     6841 tcaatttagt agcaccctac aacaggcttc tttccaacat gataaagaga tgctccaagc
     6901 acaaattgag gctactcaaa aattacaaca agatctgatg aaggttaaac aggcagtgct
     6961 cctagagggt gggttttcca cagcagatgc ggcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggcccct gatgccaggg tcacaacata
     7081 caatgcaggc cacttttcca cccctcagtc tttgggggcg ttgacaggaa ggactaattc
     7141 tagggtctct gctcctgctc ggagctcccc cagtgcactt tctaatgctc ctactgccac
     7201 ttctttgcat tcaaatcaaa ctgtttctac gagactaggt tcttcagctg gttctggtac
     7261 cggtgtctcg agtctctcgt cagctgcaag gactaggagt tgggttgagg accaaaacag
     7321 aaatttgtca cccttcatga ggggggctct caacacatca tttgtcaccc ctccatctag
     7381 tagatcctcc agtcaaagca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgcaaac gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caagattgat tatctttcct ttctttagtg tcttt
//