Typing tool

Complete norovirus genomes

NC_040876  GII.6
 GII.P7

Length: 7,521 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       NC_040876               7521 bp    RNA     linear   VRL 19-AUG-2019
DEFINITION  Norovirus GII.P7_GII.6, complete genome.
ACCESSION   NC_040876
VERSION     NC_040876.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7521)
  AUTHORS   Brown,J.R., Roy,S., Shah,D., Williams,C.A., Williams,R., Dunn,H.,
            Hartley,J., Harris,K. and Breuer,J.
  TITLE     Norovirus transmission dynamics in a paediatric hospital using full
            genome sequences
  JOURNAL   Clin. Infect. Dis. (2018) In press
   PUBMED   29800111
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 7521)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-FEB-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7521)
  AUTHORS   Brown,J.R., Roy,S., Shah,D., Williams,C.A., Williams,R., Dunn,H.,
            Hartley,J., Harris,K. and Breuer,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-APR-2018) Division of Infection and Immunity,
            University College London, 90 Gower St, London, London WC1E 6BT,
            United Kingdom
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to MH218645.
            
            ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 10.1
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7521
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="NORO_176-1_17_12_2015"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="United Kingdom"
                     /collection_date="17-Dec-2015"
                     /genotype="GII.P7_GII.6"
     5'UTR           1..4
     gene            5..5098
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /db_xref="GeneID:41284684"
     CDS             5..5098
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="YP_009555232.1"
                     /db_xref="GeneID:41284684"
                     /translation="MKMASNDATTAFGSQNSVNDSINTAPSNKEEVGAFSNIKVGFKK
                     MLGAVPKGTKAPSSDQHCPTVKIGTKTLTVPPEPPNGEDTVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVHPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNIFWTPPDVSSFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGTALKS
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDQASQTANEVGAAL
                     LRLRQARARYYVSCFQDLIYTLIQVAGASFVVNRISKRFCWERWVKPTETQETSEPEK
                     EVAQGRWEVEPKDIETEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGIKELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNENLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVKKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     mat_peptide     5..1006
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="p48"
                     /protein_id="YP_009555235.1"
     mat_peptide     1007..2104
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="NTPase"
                     /protein_id="YP_009555236.1"
     mat_peptide     2105..2623
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="p22"
                     /protein_id="YP_009684403.1"
     mat_peptide     2624..3022
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="VPg"
                     /protein_id="YP_009555237.1"
     mat_peptide     3023..3565
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="Pro"
                     /protein_id="YP_009684404.1"
     mat_peptide     3566..5095
                     /gene="ORF1"
                     /locus_tag="EXT63_gp1"
                     /product="RdRp"
                     /protein_id="YP_009684405.1"
     gene            5079..6722
                     /gene="ORF2"
                     /locus_tag="EXT63_gp2"
                     /db_xref="GeneID:41284685"
     CDS             5079..6722
                     /gene="ORF2"
                     /locus_tag="EXT63_gp2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="YP_009555233.1"
                     /db_xref="GeneID:41284685"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNEGIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICAFRGTLIGQTSRSSDSTDSAPRRRDHPLHVQLKNLDGTQYDPTDEVPAVLG
                     AIDFKGTVFGVASQRDVSGQQVGATRAHEVHINTTDPRYTPKLGSILMYSESEDFVTG
                     QPVRFTPIGMGDNDWHQWELPDYSGHLTLNMNLAPAVAPAFPGERILFFRSIVPSAGG
                     YGSGQIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRNQ"
     gene            6722..7498
                     /gene="ORF3"
                     /locus_tag="EXT63_gp3"
                     /db_xref="GeneID:41284686"
     CDS             6722..7498
                     /gene="ORF3"
                     /locus_tag="EXT63_gp3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="YP_009555234.1"
                     /db_xref="GeneID:41284686"
                     /translation="MASAFLAGLVGDVITNGVGSLINAGANAVNQKVEYDFNKQLQMA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPADAARGAVNAPMTKILDWNG
                     TRYWAPNSMKTTSYSGQFSSSPVHKSPAPSHTALPKSRLQNDSASVYSFPSSASSQST
                     HSTVLSAGTGSSRSTSTSTATPTLSRTSDWVRGQNERLSPFMDGALQTAFVTPPSSKA
                     SSNGTVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
     3'UTR           7499..7521
ORIGIN      
        1 gtgaatgaag atggcgtcta atgacgctac cactgccttt ggcagccaaa actctgtcaa
       61 tgacagtatc aacaccgccc cttctaataa agaagaggtt ggtgcattct ccaacatcaa
      121 agttggtttt aagaaaatgc tgggtgccgt tcccaagggg accaaagcac ccagtagtga
      181 tcagcactgc cccacagtta agatcgggac caaaacgtta acagttcccc ctgagccccc
      241 aaatggtgaa gacaccgtgc agtttgatgc gaagtcggaa actgtgcgtg ggctaccaga
      301 cttaacaacg gtgcagaatg aacacgaaaa cacaccatac actgtccctc cattgagtga
      361 aagggagcac agaccagcca ctgagccgct tcctggcaca atactggaga tgtgggatgg
      421 tgaattctac cattactccg tgtacgtcag cggtggcaaa gccctagggg ttcacaagcc
      481 ccctgcagcg ataagcctcg cgacgataga actcacaccc atatctcttt attggaggcc
      541 cgtttacacc cccaactatc tggtccaccc agacacgttg aaaggcctcg ctggtgagaa
      601 gttcccctac acggctttca gcaacaactg ttacaacttc tgttgctggg tgcttgagct
      661 caatgacacg tggcttagca ggaggagcat ctccaggacc accggcttct tcaaaccata
      721 tcagtcttgg aataggaagc cccttccaac cgttgatgat ggaaagatca aaaaggtggc
      781 caacgcaatc ctctgcgcac ttgggtcact attttcaaaa ccaatcaagg acctattggg
      841 taaacttaaa ccgttgaact tgctgcactt gctcgcatca tgtgactgga cgtttgcggg
      901 catagtagag acagttatcc taatggcgga acttttcaac atcttttgga caccgccaga
      961 tgtttccagc ttcatagcct ccctgatagg tgattttgaa ttacaggggc ctgaggacct
     1021 ggctgtggag cttgtccccg tggtcatggg tggcataggt atggttctcg gcttcactgc
     1081 tgagaagata ggccgcatgt tgtcgtccgc cgcatcaaca ctgcgggcat gcaaagactt
     1141 ggggaattat gcccttgaca tactgaaact ggttatgaag tggttcttcc caaagaaaga
     1201 agagaaagcc gagatggaga ccttaagggc gatcgaggac gccgtcctgg acatggaagc
     1261 tataggaaat aaccacctca caaccctcct caaggacaag gatagcctca cggccttcat
     1321 gaagactctg gatttagaag aggagaaagc aaggaaactg tccaccaagt catcctcgcc
     1381 agacatcgtt ggcactatta atgccatact ggccagaata gctgctgcca ggtccctctt
     1441 acataaggct aaggaagaaa tgtttagcag gatcagaccc gtggttgtta tgatctcggg
     1501 tagacctggc attggtaaaa cccacatggc aagacacttg gctaagagta tcgccaacac
     1561 catgagcggc gaccagagag tagggctagt cccacgcaat ggggtcgacc actgggacgc
     1621 ctacagggga gagagggtgg ttttatggga tgattatggc atgggaaacc ctgtcaaaga
     1681 tgccctaaca ctgcaagagt tggctgacac ctgcccagta actctaaact gtgataggat
     1741 tgagaacaag gggaagatgt tcgacagtga tgtcatcata atcacaacca atttagtcaa
     1801 cccagcgccc ctcgattatg taaacttcga ggcgtgctcc agaagggtcg actttctggt
     1861 ctatgcagag tcaccagaaa ttgagaaggt taagagagat ttccccggcc aacctgacat
     1921 gtggaaggac cattttaaac cagacttttc ccacataaaa ctgaccctag ccccacaggg
     1981 tggatttgac aagaacggca acaccccgca tggtaagggc accatgcgat ccttaaccca
     2041 ggggtccctg actgcaaggg ttgcaggtct tgttcatgag aggagagacg agtttcagct
     2101 ccaggggaat gaccttcaaa catacaactt tgacaccaac agggtctctg catttaggaa
     2161 gctggccgcg gacaacaagt atgggatcat ggagacaatg agagtgggta cggcgcttaa
     2221 gagtgtcaag accttggaag atctgaaagt tgccctgagg gatgtgaagt tcaatgagtg
     2281 tgagataatt tacaggaact ccaaataccg agtctcttcc aatggtaagg gctctgtctc
     2341 tgttgacaaa gttgaggacc aagcgtccca gactgcaaac gaagtgggtg cagcactcct
     2401 cagacttagg caggcaagag ccaggtacta tgtcagctgc ttccaagatc tcatctacac
     2461 tctaatacag gtcgctggag catcattcgt tgtcaacagg atctctaaaa ggttctgttg
     2521 ggagagatgg gtcaaaccaa ccgagaccca ggaaacgagc gaacccgaaa aggaagtggc
     2581 ccaaggtaga tgggaggttg aacccaagga catagagaca gaaggtaaga agggtaaaaa
     2641 caagaaagga agaggcaaga aacacacagc tttctccagc aaaggcctga gtgatgagga
     2701 gtatgatgag ttcaaaagaa tcagagaaga aaggaacgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggatcgct actatgagga agtggcagtt gcccgggcaa cagaggagga
     2821 cttctgtgaa gaggaggagg ccaagataag acaaagaatc ttccgcccca caaagaaaca
     2881 gaggaaggaa gaaagggggg ttcttggttt ggtcactggc tcagacatca ggaagaggag
     2941 accagacgat tttcaaccga agggcaacct gtgggcagac gacaccagga gtgtggacta
     3001 caacgagaga cttgatttcg aggctccccc gagtgtctgg tcaagaatag tcccattggg
     3061 cactggttgg ggcttctggg tctcttccaa tctcctgatc acaacaacac acgtcctgcc
     3121 taaggggatt aaggaacttt ttggagtcga aatcaaacag attcaaattc ataagtctgg
     3181 agagttctgc aggttcaggt tcccgagacc aatcagacca gatgtcacag ggctcgtgtt
     3241 ggaggaaggt gctccagaag gcactgtctg ctccatactc gtgaagagac ctacaggtga
     3301 gatgatccct ctggcagtga ggatgggcac gcatgcatcc atgaaaatac agggtaggac
     3361 cgtcggtggc cagatgggga tgctcctcac aggggcaaat gcaaagaaca tggaccttgg
     3421 caccggtcct ggtgactgcg gttgccctta catctacaaa cgtggcaacg atatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg aggcaacact gtcatatgtg ccactcaggg
     3541 gcaagatggg gaggcagtcc ttgagggaaa tgagaacctt ggcacttact gcggtgcccc
     3601 aattttgggt ccaggcaagg cgcccaaact tagcacgaag accaagttct ggcgttcatc
     3661 accagacgct ctgccgccag gcacttatga gcctgcctac ttgggaggca aggaccccag
     3721 agtggaaaaa ggaccatccc tgcagcaagt catgagggac cagctaaagc ccttcacaga
     3781 acccaggggc aagccaccta gacctgcagt cttagaagaa gccaaaaaga cagtgatgaa
     3841 tgttctagaa caaaccattg accctgctaa gccatggacc tattcccaag catgtgcctc
     3901 actggacaag accacttcca gcggtagccc ccatcatgtc aagaaaaatg accattggaa
     3961 tggggaatcc ttcactggcc cccttgcaga ccaagcatcc aaagccaacc tcatgtacga
     4021 acaggccaaa cacgtgcagc ccgtgtacac ggccgcactc aaagatgagt tagttaaaac
     4081 tgacaagatc tacaaaaaga taaagaaaag gctcttatgg gggtcggacc ttggcacaat
     4141 gatcagatgt gccagggcct tcggcggtct catggatagc atgaaggcaa gttgcatagc
     4201 cctcccatgt agggtaggaa tgaacatgaa tgaagatggt cccatcatat ttgacaaaca
     4261 ttctaagtat aggtaccatt atgatgctga ctattcaagg tgggactcaa cccagcaaag
     4321 gagcattctc tcggccgcta tggaagtgat ggtgcggttc tctgccgagc cagagctggc
     4381 acaagtggtt gcagaggacc tcctggcacc cagccaactg gatgttggcg actttgtcat
     4441 ctcagtacag gagggtctgc catcaggggt cccatgtaca tcacagtgga attcaatagc
     4501 acactggatc ctgaccttga gtgcaatggc agaagtgtcg ggtctctcac cagatgttgt
     4561 tcaagcccac tcctgtttct cattctacgg tgacgatgag atcgtcagca ctgacatcaa
     4621 tcttgatccc atgaagttga cacagaaact cagagaatat ggtctggtcc ccactcgacc
     4681 tgacaaaact gagggtcccc tcgtaataac tgaagacctc accggcctaa cgttcctgcg
     4741 taggtcaatt gcacgggacc cagctgggtg gtttggaaaa ctggaccaag actcaatcct
     4801 cagacagttg tactggacaa ggggccccaa tcatgagaac ccatatgaga gcatggtccc
     4861 tcactcccag cgggccacac agcttatggc ccttctcggt gaggcttcac tgcatggccc
     4921 ccagttttac aagaaggtta gcaagatggt catcaatgaa atcaaaagtg gtggtctgga
     4981 attttatgtg cccagacaag aggccatgtt cagatggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gggtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaattg cagctcctgt tgtcggccaa caaaatataa
     5221 ttgacccctg gattagagaa aattttgtcc aagcaccaca gggtgagttc accgtctcac
     5281 cgaggaactc gcctggtgag atgctattaa atcttgaatt gggcccagaa ctcaaccctt
     5341 acctgagtca cctgtcccgc atgtataacg ggtatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggga aaatcatctt tgccgccgtg ccaccacatt
     5461 ttcccgtaga aaatattagt gcagctcaaa taactatgtg cccccatgta attgtcgatg
     5521 tgagacaact tgaaccagta cttctgcccc ttcctgacat aaggaacagg ttcttccatt
     5581 acaaccagga gaacaccccc cggatgagac ttgtggctat gctttacacc cccctaaggg
     5641 ccaactctgg tgaagatgtg tttactgttt cttgtagggt tttgacccga cctgcccctg
     5701 attttgaatt tactttcctg gtaccaccaa ctgttgaatc aaagactaaa cctttcacac
     5761 tgcccatatt aactcttggt gagctatcta actccaggtt cccagcccca atagatatgt
     5821 tgtacactga cccaaatgag ggaatcgtag tccaaccaca aaatggcaga tgcactcttg
     5881 atggcactct gcaaggcacc acacaactgg tccccaccca aatttgtgct ttcaggggca
     5941 cactaattgg ccaaacatca agatcttcag actcaaccga ctcagcccct cggagaaggg
     6001 atcacccact ccatgtgcaa ttaaagaatc ttgatggcac gcagtacgac ccaactgatg
     6061 aagtgccagc agtccttggt gccattgact tcaaggggac tgtctttggg gtggccagtc
     6121 agagagatgt gtcaggacaa caagtgggag caactcgagc tcatgaagtg cacatcaaca
     6181 caaccgatcc taggtacaca ccaaaactgg ggtccattct catgtactca gagtcggaag
     6241 actttgtgac tggacagccg gtccgcttca cacccatagg aatgggtgac aacgactggc
     6301 accagtggga gctgcctgac tactctggac acctaaccct gaacatgaac cttgccccag
     6361 cagtcgctcc tgctttcccg ggcgagagga ttcttttctt caggtcaata gtcccgtctg
     6421 ctggtggcta tgggtctgga caaatagatt gcctcatacc acaggagtgg gttcagcatt
     6481 tctaccagga agctgcacca tcccaatctg ccgtggcact catcaggtat gtcaatcctg
     6541 acacaggcag gaacatcttt gaggctaaat tgcacaggga aggtttcatc accgtggcaa
     6601 attctggtaa taaccccatt gttgtccccc ctaatgggta ttttaggttt gaggcttggg
     6661 tgaaccaatt ttatactttg acccccatgg gaactggtca ggggcgtaga aggaatcaat
     6721 aatggctagt gcttttcttg caggtcttgt tggcgacgtc ataacaaatg gcgttggatc
     6781 tctaataaat gctggagcta atgcagttaa tcagaaagtt gaatatgatt tcaataaaca
     6841 gcttcaaatg gcatcgttta aacatgataa agagatgttg caatcacaag tgttggcaac
     6901 caaacagttg cagcaggaga tgatgaacat aaggcagggg gtgttgaccg ctggcggctt
     6961 ctcccccgcg gatgctgcta gaggggccgt caatgcccca atgacaaaga ttttggactg
     7021 gaatggcacc agatattggg cacctaacag catgaaaacc acaagttatt caggacagtt
     7081 ttctagcagc cctgttcaca agtcccctgc tccttctcac actgctttgc caaagagtag
     7141 attgcaaaac gattctgcta gtgtatatag ctttccttcc tctgcttcct cacaatcaac
     7201 ccattcaaca gtactgtcag caggaaccgg gtcttctagg tccacctcca catctacagc
     7261 gacccctacc ttgtctagaa ccagcgactg ggttagggga cagaacgaga ggctcagccc
     7321 gtttatggat ggtgctctcc aaactgcctt tgtcacacct ccatcgagca aagcttcttc
     7381 aaatggtacg gtctcaaccg ttcccaaagc tgttttggac tcctggaccc ctatgttcaa
     7441 cacacatagg cagcctctct tcgcccatct acgtagacga ggggagtcac aaatttagtg
     7501 aaaagagtga ttaggttttc t
//