Typing tool

Complete norovirus genomes

MN525276  GII.4 Sydney
 GII.P16

Length: 7,576 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       MN525276                7576 bp    RNA     linear   VRL 07-OCT-2019
DEFINITION  Norovirus GII isolate JH29, complete genome.
ACCESSION   MN525276
VERSION     MN525276.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7576)
  AUTHORS   Juliana,H.M., Silva,L.D., Junior,E.C., Cardoso,J.F., Massafra,J.M.,
            Lima,C.P. and Nunes,M.R.
  TITLE     Evolutionary and Molecular Analysis of Complete Genome Sequences of
            Norovirus from Brazil: Emerging Recombinant Strain GII.P16-GII.4
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7576)
  AUTHORS   Juliana,H.M., Silva,L.D., Junior,E.C., Cardoso,J.F., Massafra,J.M.,
            Lima,C.P. and Nunes,M.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2019) Virology, Instituto evandro Chagas, BR316,
            Ananindeua, Para 67030000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8.1.9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7576
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="JH29"
                     /isolation_source="Human stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="14-Sep-2016"
                     /note="genotype: GII.P16_GII.4"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEX93394.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRGEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVVRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEFQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEVNELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRSVTIKRCRIIYGGSTYDLESDGKSKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMVLEEGAPEG
                     TVVTVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTIICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGDTFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSRISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6707
                     /gene="ORF2"
     CDS             5085..6707
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEX93395.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     gene            6707..7513
                     /gene="ORF3"
     CDS             6707..7513
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEX93396.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANLRDAVPARGPSNKSS
                     NSSTATSVYSNQTISTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagaggcgaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca agaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc gttaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtccctcaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agccataagc atggcaagag tggagctgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcgttccc
      601 ttacaccgct ttcgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttctttagac cttaccaaga
      721 gtggaacaga aaacccctgc caaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga acatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgagtttcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgtaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggt
     1201 caatgagcta gccatggtga gggccataga ggatgccgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttgtcaaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggcccg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctatcta gcaggataag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtactgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc ccttacatta aattgtgaca gaattgaaaa
     1741 taagggaaaa gtttttgaca gtgaagtcat aataattaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggactttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ccaccggttc
     2041 tctgattgcc cgtgcatcag gtctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcccacaatc accaccttca atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggat tggtggatac catgaaagtt ggcaatcaac taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggagtgtg accatcaaga ggtgtcggat
     2281 catctacggt ggctccacgt atgaccttga gtctgatggc aagagcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tacagaccaa caacgaattg gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attccatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagaccaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gtcagaagat gacgagttca tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctggta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta gaattgtgag
     3061 ctttggttct ggctggggct tctgggtatc accaagcctg ttcataacat caactcatgt
     3121 gatccccgca ggcataacag aagcatttgg agtccccatc aaacaaattc agatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 ggtcttggaa gaaggtgcgc ctgaaggcac cgtggtaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcca aaggaatgga
     3421 tttgggaaca actcctggtg actgtggctg tccttacatt tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccatca tctgcgccac
     3541 acagggaagt gagggtgagg caactcttga gggcggagat gataaaggaa catactgtgg
     3601 ggcacccatt ctaggccctg ggggcgcacc aaaattgagt accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagcct gcctacctcg gtggccgtga
     3721 tccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 tatcaatgtc ctcgaacaaa ccctggaccc tccgcaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcatccccat cacgtccgaa agaatgaatt
     3961 ctggaatggt gataccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtacgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatacaaat accactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactagcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg taggggactt
     4441 taaaatcaca ataaatgaag ggctcccatc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tgtcccctga
     4561 cattatacaa gcaaactcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 catcaaattg gaccctgaac agttaaccgc caagttgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aagaccgagg gacccctgat catcagtgaa gacttgaacg gactcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagttc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tctcaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta gaatcagtaa attagtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt accagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtggg gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccctaggc cctgacctaa
     5341 atccctacct atcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaagat catatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttaagtccta gccaggtcac tatgttcccc catataatag
     5521 tagatgttag acaattagaa cctgtgctga ttcccttacc cgatgttagg aataatttct
     5581 atcattacaa tcagtcaaat gactccacta ttaagttgat agcaatgtta tatacaccac
     5641 tcagggctaa taatgctggg gatgatgttt tcacagtttc gtgccgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ttcaagattc cccatccctt
     5821 tggaaaagtt gttcacaggc cccagcagtg cctttgttgt ccaaccacaa aacggcaggt
     5881 gcacaactga tggcgtgctc ctaggcacca cccaactttc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac atcacaggta gtcgcaacta cacaatgaat ttggcttctc
     6001 aaaattggaa caactatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 ttgtggggaa gattcaaggc atgctcaccc aaaccacaag gacagatggt tcaacacgcg
     6121 gccacaaagc cacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgaaac tgacacagac catgattttg aagctaatca aaacacaaag tttaccccag
     6241 tcggtgtcat ccaagatggt agcaccaccc accgaaacga accccaacag tgggtgctcc
     6301 caagttactc aggcagaaat actcacaatg tgcatctggc ccccgctgta gcccccacct
     6361 ttccgggtga gcaacttctc ttcttcagat ccaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca atacttctac caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg caagcttcac aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttacttta gatttgattc ctgggtcaac cagttctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgtgt agtataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctgggctt ggttccctta tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcatc
     6841 cttccaattt agcagcaatc tgcaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagctaca acaggaaatg atgaaagtta agcaggcaat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgc ggggcgatta acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct ccagatgcta ggactacaac
     7081 atacaatgca ggccactttt ccacccctca accatcgggg gcactgccag gaagagctaa
     7141 tcttagggac gctgtccctg ctcggggacc ctccaacaaa tcttctaact cttctactgc
     7201 tacctctgtg tactcaaatc aaactatttc aacgaggctt ggttctacag ctggttctgg
     7261 aaccagtgtc tctagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcatttgtca ccccaccatc
     7381 tagcagatcc tccagccaag gcacagtctc aaccgtgcct aaagaaattt tggactcctg
     7441 gactggcgct tttaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg tgatgtgaaa agacaaaact gattattttt ctttttcttt agtgtctttt
     7561 aaaaaaaaaa aaaaaa
//