Typing tool

Complete norovirus genomes

MN453359  GII.24
 GII.P24

Length: 7,523 | 3 CDS

ORF1: 5..5095
ORF2: 5076..6704
ORF3: 6704..7468
LOCUS       MN453359                7523 bp    RNA     linear   VRL 18-SEP-2019
DEFINITION  Norovirus GII isolate Hu/PE/2013/GII.24[P24]/Loreto7940, complete
            genome.
ACCESSION   MN453359
VERSION     MN453359.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7523)
  AUTHORS   Chhabra,P., Browne,H., Kosek,M.N., Olortegui,M.P., Montmayeur,A.M.,
            Tatusov,R.L. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7523
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Loreto7940"
                     /isolate="Hu/PE/2013/GII.24[P24]/Loreto7940"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Peru"
                     /collection_date="29-Apr-2013"
                     /note="Amplicon sequencing: first 35 nt does represent
                     primer sequence;
                     genotype: GII.24[P24]"
     gene            5..5095
                     /gene="ORF1"
     CDS             5..5095
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEP54813.1"
                     /translation="MKMASNDASAATAGTTSTNSEIHNKDENPSSNIFANMTVGIKRA
                     LGARSKQLAPGATPNNKIGKTIIPPVPPPPPNGEDIVIKYTKQEDTVSGVPSVSTVDI
                     SPPHDTAYSVPPLDQREKVDAKEPLTGSIIEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     MSIARIELTPLSLYWRTVYTPPYLVAPDTLRKLHGETFPYTAFDNNCYSFCCWVLDLN
                     DSWLNRKFVSRTTGFYRPYQDWNRKPMPTMDEGKLKKVANVFLCGLTGLFTRPIKDII
                     GKLKPLNFLNIVANCDWTFPGVVEAIILLSELFGIFWTPPDISAFVASLLGDYEMQGP
                     EDIATEIVPVILGGIGMVLGFTKEKIGRLLGSAASSLRACREIGNYGIEVVKLVMKWF
                     FPTKSEVNEMEMVRTIEDAVLDFEAIENNHMTALLKDKNSLATFLRALDMEEEKARKL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEEMSSRMRPVVIMISGRPGIGKTHLAR
                     DLAKKMAATLSGDQRVGLVPRNGVDHWDAYKGERIVLWDDYGMSNPVADALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDTLIITTNLANPAPLDYVNFEACSRRIDFLVYADSPSV
                     DKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTHSLIA
                     RATGLLHERLDEFDLQGPELPVYNFDQNKVAAFRKLAADNKYGFMDTLRAGNKLKEVK
                     TLDQFKEAVKDIRIKPCRIIYNSLAYDLDSNGSGKVNVKKVGDQRIQANNELNSALNK
                     LRGARIRYYVKCFQEMIYSLLQIAGAAFVTSRMAQRMNVNKLWAKPEKQSETLTEPPT
                     PPIEDWTITPADTVQEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERQGKYS
                     IEEYLQDRDRYYEELAIAKATEENFCEEEEIKIRQRIFRPTRKQRKEERATLGLVTGS
                     EIRKRNPDDFKPKGKLWADDDRSVNYNERIDFEAPPSLWSRIVNFGSGWGFWVSSNLF
                     ITSTHVIPQNMSEAFGVPINQIQIHRSGEFCKMRFPKAIRPDVSGMILEEGAPEGTVV
                     TILIKRTTGELMPLAARMGTHATMKIQGRMIGGQMGMLLTGSNAKNMDLGTVPGDCGC
                     PYVYKRGNDWVVIGVHTAAARGGNTVICATQGPDGEATLEGGDNHGTYCGAPILGPGN
                     APKLSTKTKFWRSSNTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTAPRGK
                     PPRPAILEAAKETICNVLEQTIEPPQKWSYAQACASLDKTTSSGHPHHKKKNDNWNGE
                     SFTGVLADQASKANLMFEQGKHMQPVYTGALKDELVKTSKIYENIKKRLLWGSDLGTM
                     IRCARSFGGLMDEMKANCVRLPVRVGMNMNEDGPIIFEKHSKYRYHYDADYSRWDSTQ
                     QRYVLGAALEIMVRFSAEPELAQIVAEDLLSPSVMDVGDFKITINEGLPSGVPCTSQW
                     NSIAHWLLTLCAMAEVSGLSPDVIQSNSCFSFYGDDEIVSTDIKLDPQKLTDKLKEYG
                     LIPTRPDKTEGPLIIKESLEGLTFLRRDVCRDPVGWFGKLDQSSIMRQLYWTKGPNHE
                     DPSETMIPHSQRPVQLMSLLGEAALHGPAFYKKVSKLVITELKEGGMDFYVPRQEPMF
                     RWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2623
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2624..3019
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3020..3562
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3563..5092
                     /gene="ORF1"
                     /product="RdRp"
     gene            5076..6704
                     /gene="ORF2"
     CDS             5076..6704
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEP54811.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANKEVMALEPVAGGAIAAPLTGQ
                     TNIIDPWIMNNFVQAPNGEFTISPRNSPGEVLLNLELGPDLNPFLAHLSRMYNGYAGG
                     VEVQVIMAGNAFTAGKVIFAAVPPHFPVDNLSPPQVTMFPHVIVDVRTFEPILLPLPD
                     VRNSFYHYNQVNDSRMRLIAMLYTPLRSNGSSDDVFTVSCRVLTRPTPDFEFNYLVPP
                     TVESRTKPFSVPILTIGEMTNSRFPLPIDMLYTSPTENIVVQPQNGRCTLEGELLGTT
                     QLVTPNICALRGEIRGHEGSGDNHKWHFMVRSPNGAAFDPTEDVPAPLGTPDFIGDVF
                     GVLSQRNRNTDSGQSGPANRSHDAVVSTRDSRFTPKLGSVMIATWETSDIQDQPTRFT
                     PVGLENPDHYNQWQLPNYSGALTLNMGLAPSVFPTYPGEQILFFRSYIPLKGGYGDSH
                     IDCLVPQEWIQHFYQESAPSQTDVALIRYVNPETGRVLFEAKLHRQGYITVARSGSSP
                     INVPANGYFRFDSWVNQFYSLAPMGTGNGRRRIQ"
     gene            6704..7468
                     /gene="ORF3"
     CDS             6704..7468
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEP54812.1"
                     /translation="MAGAFLAGLAGDIATNTMGSLVSAGANAINQKVDFENNKFLQGE
                     SFKHDKEMLNAQVEATKKLQMDMINIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPNATTTTSMSGGFTSQVVHRPTPNFGNKQAPRPAPSIASSERSNSTQLTSLSS
                     HSSGSSRSSGSTVVSSLPSSSRTREWVDSQNFNLEPHLPGSLKTAFVTPPSSVASSSG
                     TVSTVPKGVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgcgacc gctggtacaa ccagcacaaa
       61 cagtgaaatt cacaacaaag atgagaaccc ctcatcaaac atatttgcca acatgactgt
      121 tggtataaaa agggctctgg gggcgagatc aaagcaactc gcccctggag ccacaccaaa
      181 caacaaaatt gggaaaacca tcatcccccc tgtgcccccc ccacccccaa atggtgagga
      241 catagtaatc aagtatacca aacaagagga cacggtcagt ggggtgccta gcgtctccac
      301 cgtagacata tcccctccac atgacactgc atacagtgtc ccccccctgg accaaaggga
      361 gaaggtggat gcaaaagagc ccctgactgg ttcaataata gagatgtggg acggtgagat
      421 ctatcattat gggctctacg tagagaaggg gctagttctt ggcgtgcaca aacccccagc
      481 tgccatgagc attgcgcgca tcgagctaac ccctctctct ctgtactgga gaacagtata
      541 cacaccccct tacctggttg cccctgacac ccttaggaaa ctccatggtg aaacctttcc
      601 ctatacagca tttgacaaca attgttactc attctgttgc tgggttttgg acctgaacga
      661 ttcctggctc aacagaaagt ttgtgtctcg aaccacgggc ttctacagac cctaccaaga
      721 ttggaacaga aaaccaatgc caaccatgga cgagggaaaa ctcaagaaag tggccaatgt
      781 gttcctgtgc ggcctgactg ggctgttcac caggcccatc aaagacatta taggtaagtt
      841 gaagccgctg aatttcctta acatcgttgc caactgcgac tggaccttcc ctggcgttgt
      901 ggaagcaata attctcctct cagaactttt tggcatcttt tggacaccac cagatatatc
      961 tgctttcgtt gcctccttac taggtgacta cgaaatgcaa ggccctgaag acatcgcaac
     1021 cgagatcgtt ccagtcatcc tcggcggtat tggtatggtt ctaggcttca ccaaagagaa
     1081 aattggccga ctgctgggct ctgcggcatc atcccttaga gcatgcagag agatcggcaa
     1141 ctatgggata gaggtggtga aactggtaat gaagtggttc ttcccgacca aaagtgaggt
     1201 taatgagatg gaaatggtca gaacaataga ggatgcagtg cttgactttg aggcgataga
     1261 gaacaaccac atgacagctt tactcaaaga caagaacagt ctggccacct ttctcagagc
     1321 actagacatg gaagaggaaa aggcgcggaa actgtcgacc aaatccgcct cacctgacat
     1381 agtcggcacc ataaacgcac tcttggcgag aatcgccgct gccagatccc tagttcacag
     1441 ggccaaggaa gagatgtcat ctaggatgcg tccagtcgtc atcatgattt ctgggcgacc
     1501 tgggattggg aaaacacacc tggcacgcga cctggccaaa aagatggcgg ccaccttatc
     1561 gggtgaccag agagtgggcc ttgtcccaag aaacggtgtc gatcactggg atgcatacaa
     1621 aggggagagg atcgtcctct gggatgatta tggcatgagt aaccctgtgg cagatgctct
     1681 ccggctccag gaactcgccg acacctgccc cttgacactc aactgtgaca ggatagagaa
     1741 caaagggaag gtctttgaca gtgacaccct gatcatcacc accaatctgg ccaatccagc
     1801 tcctctcgac tatgtaaact ttgaggcttg ttcacgccgc atagacttcc ttgtctacgc
     1861 ggattccccc tcagttgaca aagcaaaaag agatttcccg ggccaaccgg acatgtggaa
     1921 ggacgccttc aagtcagatt tctcacacat aaagctacaa ttagcaccac aaggaggatt
     1981 tgacaagaat ggaaacaccc ctcatgggaa gggcgtcatg aaaacactga ccacacactc
     2041 cctcatagca cgcgccactg gcttgcttca tgagaggttg gatgaatttg acctgcaagg
     2101 tccagagcta ccagtgtaca attttgatca aaacaaggtg gccgcgttcc gaaaactcgc
     2161 agctgacaac aagtatggtt tcatggacac cttgagagca ggtaacaaat tgaaggaagt
     2221 caaaaccctg gaccagttta aagaagcagt gaaggacata cgcataaaac cctgcaggat
     2281 aatttacaac tcactagcct atgatttgga ttcaaatggg tcaggaaagg tcaatgtcaa
     2341 aaaggtgggg gaccaacgaa tccaggccaa caatgagctc aactctgcac tcaacaaact
     2401 gcgcggggcc agaatcagat actatgtgaa atgtttccaa gaaatgatct actcacttct
     2461 ccaaattgct ggtgcggcct tcgtcacgtc tagaatggcg cagaggatga atgtcaacaa
     2521 actgtgggcc aagccagaaa aacagtcaga gaccctcacg gaaccaccta cccctccaat
     2581 tgaagattgg accataacac cagcagacac agtccaagag ggtaagaaag gtaaaaacaa
     2641 gagtggcagg ggcaagaagc acactgcgtt ctccagcaag ggcctcagtg atgaggagta
     2701 tgatgaatac aaaaggatca gggaagaacg tcaaggaaag tactctatag aggaatacct
     2761 ccaagacagg gaccggtact atgaagaatt ggctatagcc aaagcaacag aagagaattt
     2821 ctgtgaagag gaagaaatca aaatcaggca gaggatcttc cgcccaacca ggaagcaacg
     2881 taaggaggag agggccaccc taggtcttgt tacaggtagt gagataagga agaggaaccc
     2941 cgatgacttc aagccaaaag gcaagctgtg ggccgatgat gaccgcagtg tcaactacaa
     3001 tgagagaata gactttgaag ccccccctag tctttggtcc aggatagtca acttcggttc
     3061 aggatggggt ttttgggtct cctctaacct gttcatcact tccacacatg tcatcccaca
     3121 aaacatgtct gaagcctttg gagtgccaat aaatcagata caaatacaca ggagtgggga
     3181 attctgcaaa atgagattcc cgaaagccat cagacccgac gtttctggca tgatccttga
     3241 ggagggtgcc cctgaaggga cagttgtgac catattgatc aaaagaacaa ctggtgaact
     3301 catgccatta gcagcccgca tgggcaccca cgccaccatg aagatacaag gtagaatgat
     3361 tggaggccag atggggatgc ttctcacagg atccaacgcc aaaaacatgg accttggcac
     3421 cgtccctggt gactgtggct gtccctatgt ctacaagagg ggcaatgact gggtcgtcat
     3481 tggggtacac accgccgccg ctagaggcgg caacacagtg atctgtgcca cccaggggcc
     3541 agatggtgaa gccaccctcg agggaggtga caaccatggg acgtactgtg gtgcacccat
     3601 actagggcct ggaaacgccc caaaactcag taccaagacc aaattttgga gatcatccaa
     3661 caccccactt ccccctggca catacgaacc tgcctacctc ggaggtaaag acccaagggt
     3721 caaaggtggc ccgtcactac aacaagtcat gagggaacag cttaagccct tcacagcccc
     3781 aagaggaaaa ccgccaagac cagcgatctt ggaggccgca aaggaaacca tctgtaatgt
     3841 actagaacag accattgaac caccccaaaa gtggtcctac gcgcaagcct gcgcgtccct
     3901 agacaagaca acttcaagcg gacacccaca ccataaaaag aaaaatgaca attggaatgg
     3961 tgaatctttc actggtgttc tggctgatca ggcgtcaaag gccaacctca tgtttgagca
     4021 gggaaaacac atgcaacctg tgtacacagg agccctcaaa gatgaacttg tcaaaaccag
     4081 caaaatctat gagaacatta agaagaggct tttatgggga tcagacttgg gcacgatgat
     4141 acgctgtgct agatcatttg gtggtctcat ggacgagatg aaggcaaact gtgtgaggtt
     4201 accagtcagg gttggtatga acatgaatga ggatgggccc ataatctttg agaaacattc
     4261 aaaatacaga taccattatg atgctgacta ttctaggtgg gactcaacac aacagagata
     4321 tgtcttaggt gctgcccttg aaataatggt taggttctca gccgagccag aattggcaca
     4381 aattgtggct gaagatctct tgtcgcccag cgtcatggac gtcggtgact tcaaaattac
     4441 tataaatgaa ggcttgccct ctggggtccc atgcacgtcc cagtggaatt caattgctca
     4501 ttggttgttg acattatgtg ccatggcaga ggtctcagga ttgtcaccag atgtgataca
     4561 gtcaaattcc tgcttctcct tttacggaga cgatgagata gtcagcacag atatcaaatt
     4621 ggaccctcaa aaattaacag acaagctaaa agagtacggc ttgatcccaa ccagacctga
     4681 caagacagaa ggccctctga taatcaaaga aagtttggag ggtttaacct ttctgagaag
     4741 agatgtgtgt agagatccag ttgggtggtt tggtaaactt gatcagtctt caatcatgag
     4801 acaactgtat tggactaaag gacccaatca tgaagaccct agtgaaacaa tgataccaca
     4861 ttcccagagg cctgtgcagc tgatgtccct actaggtgaa gcagccctac atggaccagc
     4921 tttctacaaa aaggtcagca aattggttat cactgaactc aaagaaggtg gaatggattt
     4981 ctatgtgccc aggcaagagc ctatgtttag atggatgagg ttctccgatc tgagcacgtg
     5041 ggagggtgat cgcaatctag ctcccgaggg tgtgaatgaa gatggcgtcg aatgacgctg
     5101 ctccatctaa tgatggtgct gccaacctcg taccagaggc caacaaagag gttatggcat
     5161 tggaaccagt ggcgggcggg gcaatcgccg cacccctcac tggtcaaaca aatataattg
     5221 acccctggat catgaataat tttgtgcaag caccaaatgg tgaatttaca atatctccca
     5281 gaaattcccc aggagaagtg ttgttaaatc tagagttagg accagacctc aaccctttcc
     5341 ttgcccattt gtctagaatg tataatggat atgcgggggg agtggaggtg caagtgatta
     5401 tggctggcaa cgctttcacc gcgggaaaag tcatcttcgc agctgtacca ccgcacttcc
     5461 cagttgacaa cctcagcccc cctcaggtga ctatgtttcc acatgttata gttgatgtta
     5521 ggacctttga gccaatccta cttccccttc cagatgtgag aaatagcttc tatcattata
     5581 atcaggtgaa tgattcaagg atgaggttga ttgctatgct gtatacccca ctgagatcaa
     5641 atggttcttc cgatgatgtt ttcactgtat cctgtagagt tttgactagg cccaccccag
     5701 attttgagtt caactacctg gtcccaccta ctgtcgaatc aagaacaaaa cccttcagtg
     5761 tgcccatcct aactattgga gaaatgacaa attcaaggtt tccactgccc atagacatgc
     5821 tgtacaccag cccaactgaa aacatagtag ttcagcccca aaatggtagg tgcacgttgg
     5881 aaggagaact actgggcaca acccagttag tgaccccgaa catctgcgcg ctacgtgggg
     5941 agatcagggg gcatgaaggc agtggtgaca accacaaatg gcattttatg gtgaggagcc
     6001 ccaatggggc agcttttgac ccaactgagg atgtgcccgc ccccctaggc acccctgatt
     6061 tcataggtga tgtgtttgga gtcctctcac aaagaaacag aaacactgac agtggtcagt
     6121 ctggtcctgc aaacagatca catgatgctg ttgtttccac aagggacagc agattcactc
     6181 caaaactagg atctgtgatg atagccacct gggagaccag tgacatccaa gaccagccca
     6241 ccagattcac tccagtaggc cttgaaaacc ctgatcatta caaccaatgg caattaccaa
     6301 attattcagg ggcattaact ctaaacatgg ggctggcccc atctgtgttt ccaacctacc
     6361 ccggagagca aatcctcttc ttccgctcgt acatcccact taagggcgga tatggagatt
     6421 cccacattga ttgcctggta ccacaggaat ggatccaaca tttctaccaa gaatcagccc
     6481 cctcacaaac tgatgtggca ttaatcaggt atgtgaaccc cgaaacagga cgtgtcctgt
     6541 tcgaggccaa gttgcatagg caaggttaca taacagttgc aaggagtggc agcagtccca
     6601 tcaatgtccc ggccaatggc tatttcagat tcgactcctg ggtcaaccaa ttctactcac
     6661 tcgcccccat gggaactgga aacgggcgca gaaggatcca ataatggcag gagctttctt
     6721 agcaggattg gcaggcgata tcgccactaa caccatgggg tctttggtca gtgcaggggc
     6781 taatgcaatc aatcagaaag ttgattttga gaataataaa tttcttcaag gtgaatcttt
     6841 taagcatgat aaggaaatgt tgaatgcaca ggttgaagcc acaaagaaac tccagatgga
     6901 catgattaac atcaaacaag gggtcttgac tgctggggga ttttccccca ctgatgcagc
     6961 ccggggggcc atcaacgcac ccatgactaa ggtgctggat tggaatggga caaggtactg
     7021 ggcaccgaat gccaccacca caacctcaat gtctggtggc ttcactagtc aggtcgtgca
     7081 caggccaaca ccaaattttg ggaacaagca agcccccagg cccgcgccta gcattgcttc
     7141 atctgagaga tcaaattcta cccaactcac cagtctgagc tcccactcct ctggatcttc
     7201 gaggtccagt ggatccaccg tggtcagctc actgccctct tcgagtagga ctagggagtg
     7261 ggtagacagt caaaatttca atttggaacc ccatttgcct gggtcgctga agacagcctt
     7321 tgtcacccca ccatcaagtg ttgcttcaag ctcaggaaca gtctcaactg tgcctaaagg
     7381 tgttttggac tcctggacat ctgcgtttaa cacgcgcaga cagccgctct tcgcacacct
     7441 tcgtagaagg ggggagtcaa atgtttagtg aaaagattgt ttgattaaat ttgatttaat
     7501 ttggcttaaa tcttttaaaa aaa
//