Typing tool

Complete norovirus genomes

MN453358  GII.23
 GII.P23

Length: 7,530 | 3 CDS

ORF1: 5..5095
ORF2: 5076..6707
ORF3: 6707..7471
LOCUS       MN453358                7530 bp    RNA     linear   VRL 18-SEP-2019
DEFINITION  Norovirus GII isolate Hu/PE/2011/GII.23[P23]/Loreto5841, complete
            genome.
ACCESSION   MN453358
VERSION     MN453358.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7530)
  AUTHORS   Chhabra,P., Browne,H., Kosek,M.N., Olortegui,M.P., Montmayeur,A.M.,
            Tatusov,R.L. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7530
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Loreto5841"
                     /isolate="Hu/PE/2011/GII.23[P23]/Loreto5841"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Peru"
                     /collection_date="25-Jun-2011"
                     /note="Amplicon sequencing: first 35 nt does represent
                     primer sequence;
                     genotype: GII.23[P23]"
     gene            5..5095
                     /gene="ORF1"
     CDS             5..5095
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEP54808.1"
                     /translation="MKMASNDASAATAGTTSTNSEIHNKDGNTTSNLFANMTVGIKKA
                     LGARSKQSAPGAQTTNKNGRTTIPPIPPPPPNGEDIVIKYTKQEDTVSGVPTVSTADI
                     SPLHDTAYSVPPLDQREKVDAKEPLTGSILEMWDGEIYHYGLYVERGQVLGVHKPPAA
                     VSIARIELTPLSLYWRTVYTPPYLVAPDTLKKLHGETFPYAAFDNNCYSFCCWVLDLN
                     DSWLNRKFVSRTTGFYRPYQEWNRKPLPTMDEGKLKKVANVFLCGLSGLFTRPIKDLI
                     GKLKPLNILNIVTNCDWTFPGVVEAVILLAELFGIFWTPPDISAFVASLLGDYEMQGP
                     EDIATEIVPVILGGIGMVLGFTKEKIGRLLSSAASSLRACREIGNYGIEVVKLVMKWF
                     FPTKSEVNEMEMVRTIEDAVLDFEAIENNHMTALLKDKNSLATFLRALDVEEEKARRL
                     STKSASPDIIGTINALLARIAAARSLVHRAKEEMSSRMRPVVIMISGRPGIGKTHLAR
                     DLAKKMAATLSGDQRVGLVPRNGVDHWDAYKGERIVLWDDYGMSNPVTDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDTIIITTNLANPAPLDYVNFEACSRRIDFLVYADSPSV
                     DKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTPHSLIA
                     RATGLLHERLDEFDLQGQELPVYNFDQNKVAAFRKLAADNKYGLMDTLRAGNKLKEVK
                     SLDQFKEAVKDIRIKPCRIIYNSMAYDLDSNGSGRVNVKKVGDQKVQANNELNSALNK
                     LRGARIRYYVKCFQEMVYSLLQIAGAAFVTSRIAQRMNVNKLWTKPEKQQEASAGPPT
                     PPTEEWTITPMDTIQEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERQGKYS
                     IEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRREERATLGLVTGS
                     EIRKRNPDDFKPKGKLWADDDRSVNYNERIDFEAPPSLWSRIVNFGSGWGFWVSSNLF
                     ITSTHVIPQNMSEAFGVPISQIQIHRSGEFCKMRFPKAIRPDVSGMILEEGAPEGTVV
                     TILIKRPTGELMPLAARMGTHATMKIQGRMIGGQMGMLLTGSNAKNMDLGTVPGDCGC
                     PYVYKRGNDWVVIGVHTAAARGGNTVICATQGPDGEATLEGGDNHGTYCGAPILGPGN
                     APKLSTKTKFWRSSNTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTAPRGK
                     PPRPAVLEAAKETICNVLEQTIEPPQKWSYAQACASLDKTTSSGHPHHKKKNDNWNGE
                     SFIGVLADQASRANLMYEQGKHMQPVYTGALKDELVKTSKIYETIKKRLLWGSDLGTM
                     IRCARSFGGLMDEMKANCVNLPVRVGMNMNEDGPIIFEKHSKYRYHYDADYSRWDSTQ
                     QRCVLGAALDIMVRYSAEPELAQIVAEDLLSPSVMDVGDFKITINEGLPSGVPCTSQW
                     NSIAHWLLTLCAMSEVSGLSPDVVQSNSCFSFYGDDEIVSTDIKLDPQKLTDKLREYG
                     LIPTRPDKTEGPLIIRESLEGLTFLRRDVCRDPAGWYGKLDQSSIMRQLYWTKGPNHE
                     DPNETMIPHSQRPVQLMSLLGEAALHGPTFYKRVSKLVITELKEGGMDFYVPRQEPMF
                     RWMRFSDLSTWEGDRNLAPESVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2620
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2621..3019
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3020..3562
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3563..5092
                     /gene="ORF1"
                     /product="RdRp"
     gene            5076..6707
                     /gene="ORF2"
     CDS             5076..6707
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEP54809.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNETMALEPVAGGAIAAPLTGQ
                     TNFIDPWIRGNYVQAPNGEFTVSPRNSPGEILLNLELGPELNPFLSHLSRMYNGYAGG
                     IDVQVIMAGNAFTAGKIIFAAIPPHFPVENLSPPQITMFPHIIVDVRTLEPINIPVPD
                     VRNNFFHYNQNNESRMRLVAMLYTPLRSNGSAEDVFTVSCRVLTKPSADFEFNYLVPP
                     TVESRTKPFTIPILTIGEMTNSRFPVPIDMLHTSPTENIVVQPQNGRCTIDGELLGTT
                     QLITSNICSFRGSISGHEGNDDEHLWHFNITNPNGTPFDPTEDVPAPLGTPDFRGQLY
                     GVISQRDREGTPSANNQKANRSHQGVISTISPKFVPKLGSVMIGTWTTDDIKNQPSKF
                     APIGLNDDDNFKQWELPNYSGALTLNMGLAPSVFPTYPGEQILFFRSYLPMKGGYGSP
                     FIDCLVPQEWVAHFYQESAPAQTDVALIRYVNPETGRVLFEAKLHRQGFITVSKSGDS
                     PINVPANGYFRFDSWVNQFYSLAPMGTGNGRRRIQ"
     gene            6707..7471
                     /gene="ORF3"
     CDS             6707..7471
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEP54810.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGANAINQKIDFENNKYFQNA
                     SFAHDKDMLNAQVEATKKLQADMIAIKQGVLVAGGFSPTDAARGAINAPMTRALDWNG
                     TRYWAPNATSTTSMSGGFTGQVSHRTTPNFKTNQAPKPPPSSGSSVRSNSTQLTSLSS
                     HSSGSSRSSGSTMVSSLPSSSRTRDWVNQQNLNLEPHLPGSLRTAFVTPPSSSASSSG
                     TVSTVPKGVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgcgacc gctggcacaa ccagcacaaa
       61 cagtgaaatt cacaacaaag atggaaatac aacatcaaac ctatttgcca acatgactgt
      121 tggcataaag aaggctctag gggcgagatc aaaacagtcc gcccctggag cccaaacaac
      181 taacaagaat gggagaacca ccatccctcc catacccccc ccacccccaa atggtgagga
      241 catagtcatc aagtatacca aacaagagga tacagtcagt ggagtgccca ccgtctccac
      301 tgcagacata tccccattgc atgacaccgc atatagtgtc ccccccttgg accagaggga
      361 aaaggtggac gcaaaagaac ccctaactgg gtcaatactt gagatgtggg atggtgagat
      421 ctaccattac gggctctatg tggagagagg gcaagtcctc ggtgtgcaca aaccaccagc
      481 tgctgtgagc attgcacgca tcgagctgac ccccctctct ctatactgga gaacagttta
      541 cacacctccc tacctggtag ctcctgacac ccttaagaag ctccatggtg agacattccc
      601 ctacgcagca tttgataaca actgctactc attttgttgt tgggttctgg acctgaacga
      661 ctcgtggctc aatagaaaat tcgtgtcaag gaccacaggc ttctacagac cctaccagga
      721 gtggaacagg aaaccattgc caaccatgga cgaaggaaag cttaagaagg tggccaacgt
      781 cttcctgtgt ggcttgtctg ggcttttcac caggcccatc aaagatctca taggcaaact
      841 gaaaccactg aacattctta acattgtcac caattgtgat tggacgttcc cgggagtcgt
      901 agaggcggtc atcctcctcg cagagctctt tgggatcttc tggacaccac cagacatatc
      961 tgccttcgtc gcctctctgt taggtgacta tgagatgcaa ggccccgagg acattgcgac
     1021 cgaaatagtc ccagtcattc taggtggtat tggcatggta cttggtttca ctaaagagaa
     1081 gatcggccgg ttgctgagtt ccgcggcatc atcactcagg gcctgcaggg aaatcggcaa
     1141 ctatgggata gaggtggtaa aattggtgat gaaatggttc tttccaacca aaagtgaggt
     1201 caatgagatg gaaatggtca gaacaataga ggacgcagtg ctcgactttg aggcaattga
     1261 aaacaatcac atgacagctc tactcaaaga caaaaatagt ctggccacct tcctcagggc
     1321 actggatgtg gaagaagaga aagcgcggag attatcaacc aaatccgcgt cccccgacat
     1381 aatcggcact ataaatgcac tcctggcgag aattgccgct gctaggtcac tggtgcacag
     1441 ggctaaggaa gagatgtcat caaggatgcg tcctgttgtc atcatgatat ccggacgacc
     1501 tgggataggg aaaacccatc tggcccgcga cctagctaag aagatggcgg ccactctgtc
     1561 aggtgaccag agagtgggcc tggtcccaag gaatggtgtt gaccattggg atgcatacaa
     1621 gggagaaagg atcgtcctgt gggatgatta cggtatgagc aaccccgtga cagacgccct
     1681 ccgactccag gaactcgccg atacatgccc cctgacactc aactgtgata ggatagagaa
     1741 taaaggaaag gtctttgaca gtgacaccat aatcatcact actaacctgg ccaacccggc
     1801 ccccctggac tatgtgaact ttgaagcttg ctcacgccgc atagatttcc tcgtttatgc
     1861 ggactctcct tcagttgata aggcaaagag agacttccca ggccaaccag acatgtggaa
     1921 agacgccttc aaaccagatt tctcacacat aaagctacaa ctggcaccac agggaggatt
     1981 tgacaagaat gggaacaccc cacatgggaa gggcgtcatg aaaacactaa ccccacactc
     2041 cctcatagcc cgtgccactg gtttactcca tgagagatta gatgaatttg acttacaggg
     2101 tcaagaattg ccagtctaca actttgacca gaacaaggtg gccgctttcc ggaaactagc
     2161 ggccgacaac aagtatggtc tcatggacac tttgagggca ggcaacaaac tgaaggaggt
     2221 taagagtcta gaccaattca aggaagcggt gaaagacatc cgcataaagc cttgcaggat
     2281 aatctacaac tcaatggctt atgacctgga ttcaaatggg tcaggcagag tcaatgttaa
     2341 gaaagtggga gaccaaaagg tccaggccaa caatgaactc aactccgcac tcaacaaact
     2401 gcgcggggct agaatcagat actatgtgaa gtgcttccag gaaatggtct actccctcct
     2461 ccagattgct ggtgcggcct tcgttacatc aagaatagca caaagaatga atgtcaacaa
     2521 gctgtggaca aaaccagaaa aacaacagga ggcctctgca gggcccccca cccccccaac
     2581 tgaagagtgg accataacac caatggacac gatccaggaa ggtaagaagg gcaagaacaa
     2641 aagtggtagg ggtaagaaac acactgcatt ctctagtaag ggccttagtg atgaggagta
     2701 tgatgagtac aagagaatca gggaggagcg ccaagggaag tactccatag aagaatacct
     2761 ccaggacagg gaccggtact atgaagaatt ggccatagcc aaagcaacag aggaggactt
     2821 ctgtgaagag gaggagatca agataaggca aagaattttc cgcccaacca ggaaacagcg
     2881 tagggaggag agagccactc taggccttgt cacaggcagt gaaattagaa agaggaaccc
     2941 cgatgatttc aaaccaaaag gaaaactgtg ggctgatgat gaccgtagtg tcaactacaa
     3001 tgaaaggata gactttgaag ctcctcccag cctctggtcc agaatagtca acttcggttc
     3061 gggttggggc ttctgggtct catcaaattt gttcatcacc tccacacacg tcatcccaca
     3121 aaacatgtct gaagctttcg gagtgccaat aagccagatc caaatacata ggagtggaga
     3181 gttctgcaaa atgaggttcc caaaggccat caggcccgat gtctctggca tgattcttga
     3241 ggaaggcgcg cctgaaggca cggtggtgac catattgatc aaaagaccaa ctggtgaact
     3301 catgccattg gcagctcgca tgggcaccca cgccaccatg aaaatacagg ggaggatgat
     3361 tggaggtcaa atggggatgc ttctcacagg atccaacgcc aaaaacatgg accttggcac
     3421 cgtgcctggt gactgtggct gcccttatgt ctacaaaaga ggcaatgatt gggtagttat
     3481 cggggtgcac accgccgccg ccaggggtgg caacacggtg atctgtgcca ctcaggggcc
     3541 agatggtgaa gccacacttg agggtggcga caaccatgga acctattgtg gcgcgccaat
     3601 attaggacct ggaaacgccc cgaaactcag caccaagacc aaattctgga ggtcctccaa
     3661 cactccgctt ccccctggca cttacgaacc agcctacctc ggtggtaagg acccaagggt
     3721 caagggcggc ccatcactac aacaagtcat gagagagcaa ctcaagccct tcactgcccc
     3781 acgtggaaaa ccaccaaggc cagcggtttt ggaggccgcc aaggaaacca tctgcaatgt
     3841 gctggagcaa accattgaac cgccccaaaa gtggtcctat gcacaggctt gtgcttccct
     3901 agacaaaaca acctcaagtg gccaccccca ccacaagaag aaaaatgaca attggaacgg
     3961 ggaatccttc attggtgttc tggctgatca ggcttcaaga gcaaacctca tgtatgagca
     4021 agggaaacac atgcagcctg tgtacacagg cgcgctcaaa gatgagcttg tcaaaaccag
     4081 caagatctat gaaaccatta agaagagact cttgtggggt tcagacctcg gcacaatgat
     4141 acgctgtgcc aggtcatttg gtggtctcat ggatgaaatg aaggcaaact gtgtgaacct
     4201 accagtcaga gttggcatga atatgaatga agatggtccc ataatctttg aaaagcattc
     4261 aaagtacaga tatcactatg atgctgacta ttccaggtgg gactcaacac aacagagatg
     4321 tgtcctgggt gctgcacttg atataatggt tagatactca gccgaaccag aactggcaca
     4381 aatcgtggct gaggacttgc tgtcgcctag cgtcatggac gttggcgact ttaaaatcac
     4441 cataaatgag ggcttaccat cgggagtccc gtgcacatcc cagtggaact caatagctca
     4501 ttggctgtta acactctgtg ccatgtcaga agtctcagga ctgtcaccag atgtggtaca
     4561 gtcaaattca tgcttctcct tctatgggga tgatgaaata gtcagcactg acatcaaatt
     4621 ggacccccaa aaactgactg acaagttgag agagtatggc ttaattccaa ctaggcccga
     4681 caaaacagaa ggaccactta taatcagaga gagtctagaa ggcctaacat tcttaaggag
     4741 ggatgtgtgc agagacccag cagggtggta tggcaaactt gaccaatcat caatcatgag
     4801 acagttatac tggacaaaag gacccaacca tgaggacccc aatgaaacaa tgatcccaca
     4861 ttcccagagg ccagtgcaat tgatgtccct gcttggtgag gcggccctac acggaccgac
     4921 attctacaag agagttagca agttggtcat cactgaatta aaggaaggtg gaatggattt
     4981 ctatgtgccc agacaagaac ctatgtttag atggatgaga ttctctgact tgagcacgtg
     5041 ggagggcgat cgcaatctgg ctcccgaaag tgtgaatgaa gatggcgtcg aatgacgccg
     5101 ctccatctaa tgatggtgca gccggtctcg taccagagat caacaacgag acaatggctt
     5161 tggaaccagt ggcaggagga gcaattgcag ccccactaac tggacaaaca aatttcattg
     5221 atccctggat tagaggtaat tatgtgcaag caccaaatgg tgaatttaca gtgtccccca
     5281 gaaattcgcc cggtgaaatt ttgcttaatt tagaattagg ccctgaactc aacccattct
     5341 tgtcccatct atctagaatg tacaatgggt atgctggcgg tattgatgtc caagtcatca
     5401 tggcaggcaa tgccttcacc gctggtaaga tcatctttgc agcaatacct ccccatttcc
     5461 ccgtggaaaa tcttagtccc cctcagatca ctatgttccc tcatattata gtggatgtca
     5521 ggacccttga acccataaat atccctgtac cagatgttag gaacaacttc ttccattata
     5581 atcaaaacaa tgagtctcgc atgagactgg tggccatgtt gtatacccct cttaggtcta
     5641 acgggtctgc tgaagatgtt ttcacagtgt catgtagggt cttaacaaaa ccatctgcag
     5701 actttgaatt taattatcta gtccccccaa ctgtagagtc aaggactaaa cccttcacaa
     5761 taccaatact cacaattggg gaaatgacaa attcaagatt cccagtgcct attgacatgc
     5821 tccatactag tccaacagaa aacattgttg ttcaaccaca aaatggcagg tgcaccatag
     5881 atggtgagtt gcttggcacc actcaactga tcacttccaa tatctgttca ttcagaggat
     5941 ccatctcagg gcatgaaggc aatgatgacg aacacctgtg gcacttcaac atcacaaacc
     6001 ccaatggcac tccatttgac cccactgaag atgtgcctgc ccccctcgga accccagatt
     6061 tcaggggtca attgtacggt gtcatctccc agcgagacag agagggaaca ccctcggcga
     6121 acaatcagaa ggcaaacagg tcccaccagg gagtgatttc aacaatctca ccaaaatttg
     6181 tccctaagtt aggttcagtc atgattggca catggactac tgatgatatc aagaaccagc
     6241 catccaagtt cgccccaatt ggcctcaatg atgatgataa ttttaaacaa tgggaactgc
     6301 caaattattc tggggcgctc accctcaaca tggggttggc acctagtgtt ttccccacct
     6361 atcctggtga acaaatcctt ttcttccgct cctatctgcc aatgaaggga gggtacggta
     6421 gtccatttat tgactgccta gtacctcaag aatgggtcgc tcacttctac caggagtcag
     6481 cacccgcaca aacagatgtg gccctaatca ggtatgtaaa ccccgaaaca ggacgtgtcc
     6541 ttttcgaggc caaattgcac agacaggggt tcattaccgt ttccaagagc ggcgacagcc
     6601 ccatcaatgt gcctgccaat ggttatttta ggtttgattc ttgggttaat cagttttact
     6661 ctcttgcccc catgggaact gggaacgggc gcagaaggat tcagtaatgg ctggagcttt
     6721 tatagcagga ttggctggtg acatgctcac aaacaccgta gggtctctag ttaatgcagg
     6781 agctaatgct attaatcaga aaattgattt tgagaataat aaatatttcc aaaatgcatc
     6841 atttgcccat gataaggata tgctgaatgc acaggttgag gcgaccaaga aacttcaggc
     6901 tgacatgatt gccatcaagc aaggggtatt agtcgcgggc ggcttttccc ctactgatgc
     6961 agctcgggga gcaatcaacg cccccatgac aagagctcta gattggaatg gaacaaggta
     7021 ctgggcgcca aatgccacct ccaccacttc aatgtcaggt ggcttcacag gacaggtttc
     7081 gcacaggacc acaccaaatt ttaaaaccaa ccaggccccc aagcccccac ctagtagtgg
     7141 gtcttcagta agatccaact caacccaact cactagtctg agctcccact cctctgggtc
     7201 atcccgatcc agcggatcaa caatggttag ctctttgcct tcttctagca ggactaggga
     7261 ttgggtcaat caacaaaatc ttaatttgga accacacttg cctgggtctc tcagaacagc
     7321 ttttgtcact ccaccatcta gttcagcctc tagttcaggc acagtctcaa ccgtgcccaa
     7381 gggtgttttg gactcctgga catctgcatt caacacacgc agacagccgc tttttgcaca
     7441 ccttcgcaga aggggggagt caaatgttta gtgaaaagat tattttaaat ttgatttaat
     7501 ttgaatttga ttggcatctt ttaaaaaaaa
//