Typing tool

Complete norovirus genomes

MN448477  GI.3
 GI.P3

Length: 7,738 | 3 CDS

ORF1: 95..5404
ORF2: 5388..7025
ORF3: 7025..7672
LOCUS       MN448477                7738 bp    RNA     linear   VRL 18-SEP-2019
DEFINITION  Norovirus GI isolate Hu/US/2013/GI.3[P3]/Westport0085, complete
            genome.
ACCESSION   MN448477
VERSION     MN448477.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7738)
  AUTHORS   Barclay,L., Bryant,P., Montmayeur,A.M., Tatusov,R.L., Chhabra,P.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7738
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /strain="Westport0085"
                     /isolate="Hu/US/2013/GI.3[P3]/Westport0085"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122928"
                     /country="USA"
                     /collection_date="13-Aug-2013"
                     /note="Amplicon sequencing: first 35 nt does represent
                     primer sequence;
                     genotype: GI.3[P3]"
     gene            95..5404
                     /gene="ORF1"
     CDS             95..5404
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEP29902.1"
                     /translation="MARIRGRIGPQRGETTTKIKDASMALDLLRRSQTPSPSRQESPP
                     KSQRDRPPRTASEVKKVMGWDVEPEHQESTAKAWCDLTQEEKEEIMRNNERLFDAGGI
                     TPSTLPSTFERADPVDSPSEQQPVTWSASGGVDIGVNDLTTVRGPFWNMCPLPPLDAR
                     NNGPAKEPLIGDMIEFYEGHIFHYAIYIGQGKTIGVHSPQAAFSIPRITIHPLVAWWR
                     VCYVPTNQQRLTYDQLRELENEPWPYASITNNCYEFCCRVMALDDTWLERRLVSTGKF
                     NHPTQDWSRDTPDFHQDSKLEMVRDAVLSAINGLVSQPFKNILSKIKPLNVLNLLSNC
                     DWTFMGVVELIVLLAELFDVFWTPPDISSFIASLLPEFHLQGPEDLARDLVPLILGGI
                     GLAIGFTRDKVTKVMKSAVDGLRSATQLGQYGLEIFSIIKKYFFGGDQTEKTLRGIED
                     AVIDMEVLSSTNVTQLVKDKKLARTYMNVLDNEEEKARKLSVRSADPHIVTSVNNLIS
                     RISMARSALAKAQAEMTSRPRPVVIMMCGPPGIGKTKAAEHLAGRLANEIRPGGKVGL
                     VPRESIDHWDGYHGEDVLLWDDYGMSKITEDCNKLQAIADTAPLSLNCDRIENKGMQF
                     SSDAIIITTNAPGPAPVDFVNLGPVCRRVDFLVYCSAPEIEQMRRTHPGDANAIKDLY
                     KRDYSHLKMELAPQGGFDSQGNTPFGKGIMKPTTLNRLLIQATALAMERQDEFRLQGA
                     VYNFDEDRVSAFTSLARANGLGLLSMATLGKRLRSVKSMEGLRNALVGYKIGECDIIW
                     NTRVYSIKSDGSIVTIKEKQTPTSPQYQAISTATLALSRLRAARALAYASCLQSAVLS
                     ILQVAGSALVVSRAVKRMFGTRTEQPMLEGKHREHNCRVHRAEAAGHGPIGHDGVIER
                     YGLCESEQEEEGEQTIELPTANKEGKNKGKTKKGRGRKSNFNAFSRRGLSDEEYEEYK
                     KIREEKSGNYSIQEYLEDRQRYEEELAEVQAGGDGGIGETEAEIRHRVFYKSKSGMRK
                     QRQEERRQLGLVSGSEIRKRKPIDWTPPKNDWSEDTRTVNYDEHISFEAPPSIWSRVV
                     KFGSGWGFWVSSTVFITTTHVIPPGAKEVFGEDLSNVAIHRVGEFTQFRFSKKMRPDL
                     TGMVLEEGCPEGTVCTIMIKRDSGELLPLAVRMGAVASMKIQGKLMHGQSGMLLTGAN
                     AKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAIQGGDGEATLEGGG
                     QNKGHYAGHPILRYGNGPSLSTKTKFWKSTPQPLPPGTYEPAYLGGRDPRVEGGPSLQ
                     QVLRDQLKPFAEPRGRLPEAGLLEAAVETVTNAIEQVMDTPVAWSYSDACMSLDKTTS
                     SGHPHHKKKNDDWNGSSFVRELGDQAAHANSMYELGKSMKPVYTAALKDELVKPDKVY
                     TKIKKRLLWGADLGTVIRAARAFGPFCEAIKPHVIKLPIKVGMNAIEDGPLIYAEHSK
                     YKFHYDADYTAWDSTQNREIMMESFNIMCKLTANPSLAAVVAQDLLSPSEMDVGDYVI
                     SVKDGLPSGFPCTSQVNSINHWILTLCALSEVTGLSPDVIQSQSYFSFYGDDEIVSTD
                     IEFDPIRLTQILKEYGLKPTRPDKTDGPIIVRQQVDGLVFLRRTISKDAIGYQGRLDR
                     NSIERQLWWTRGPNHEDPFETLVPHSQRKIQLISLLGEAALHGEKFYRKIAGRVIQEV
                     KEGGLEIYIPGWQAMFRWMRFHDLSLWTGDRDLLPDYVNDDGV"
     mat_peptide     95..1219
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1220..2308
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2309..2908
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2909..3328
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3329..3871
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3872..5401
                     /gene="ORF1"
                     /product="RdRp"
     gene            5388..7025
                     /gene="ORF2"
     CDS             5388..7025
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEP29903.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEANTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVKVLLAGNAFTAGKIIVSCIPPGFVAQNISIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDNTPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFL
                     FLVPPNVEQKTKPFSVPNLPLDTLSNSRVPSLIKSMMVSRDHGQMVQFQNGRVTLDGQ
                     LQGTTPTSASQLCKIRGSVFHANGGNGYNLTELDGSPYHAFESPAPIGFPDLGECDWH
                     MEASPTTQFNTGDVIKQINVKQESAFAPHLGTIQADGLSDVSVNTNMIAKLGWVSPVS
                     DGHKGDVDPWVIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIAHGTNGLSVPC
                     TIPQEFVTHFVNEQAPTRGEAALLHYLDPDTHRNLGEFKLYPDGFMTCVPNSSGTGPQ
                     TLPINGVFVFVSWVSRFYQLKPVGTAGPARRLGIRRS"
     gene            7025..7672
                     /gene="ORF3"
     CDS             7025..7672
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEP29904.1"
                     /translation="MAQAILGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQKN
                     SFIHDKEMMGLQVEASTALLQNSLGTRYNMLTKAGMTSADAARMVVGAPTTRVIDWNG
                     TRIAAPMSTATTLRSGGFMTVPTVYRGGKNKQSIGGGFSNVNYDPSVSSSRTSQWVSS
                     QNSMRSTLEPFHPGALRTTWVTPPGSTSTSTISTVSTVPKFFNTERLPLFANRGK"
ORIGIN      
        1 gtgaatgatg atggcgtcta acgacgctat tgccgttgct gatgtcagca ataacaatgc
       61 taacaccaac aatgataaca ttgggtcccg ccttatggcg aggatccgtg ggcgcatagg
      121 cccacaacgt ggtgaaacaa ccacgaagat aaaagatgcc agtatggcgc ttgatctgct
      181 gcgccggtca caaacacctt ccccatcccg acaggagagc ccccccaaga gccagaggga
      241 ccgcccccct cggaccgctt ctgaggtaaa gaaagtgatg gggtgggatg tcgagccaga
      301 acatcaggaa agcacagcta aggcatggtg cgacctcacg caagaagaga aggaggaaat
      361 aatgcgtaac aatgaaaggc tcttcgacgc tggaggaatc accccatcaa ctttacctag
      421 cacgtttgag agggccgacc cggttgacag ccccagtgaa caacaacctg tgacatggtc
      481 tgctagtggt ggggtcgata ttggtgttaa tgatcttacc accgtccgtg gcccattttg
      541 gaacatgtgc cccctcccgc cactggatgc ccggaataat ggccccgcta aggagcccct
      601 cataggggac atgatagagt tttatgaagg tcacatattc cattatgcca tctatattgg
      661 acaaggcaag accattgggg tccactcacc gcaagcggct ttctccatac caagaataac
      721 catccatcct ctagtagcct ggtggcgcgt gtgctacgtt ccaactaatc agcagcgcct
      781 cacttacgac caactcagag aactggagaa tgagccgtgg ccctacgctt ctatcacaaa
      841 taattgctat gagttttgct gtagggtgat ggcacttgac gacacatggc ttgagaggag
      901 gttggtcagt actggaaaat tcaaccaccc cacacaagat tggtcacgag ataccccgga
      961 tttccaccaa gattcgaagc ttgagatggt aagagatgct gtgctatcag ctatcaacgg
     1021 cctcgtatcg caacccttca aaaacatatt gtcaaagatc aaaccattaa atgttcttaa
     1081 tctcttgtca aattgtgatt ggactttcat gggggttgta gaattgatcg tactcctagc
     1141 ggagttgttt gatgtgttct ggactccacc agatatttca agcttcattg cctcactact
     1201 acctgaattt cacctgcagg gcccagaaga cctagctagg gacttggttc ctctcattct
     1261 aggtggcata ggcctagcta ttggctttac aagagataaa gtgacaaaag tgatgaagag
     1321 cgccgtcgat gggctgcgat cggcaacaca gcttgggcag tacggactgg aaatattctc
     1381 aatcattaag aaatatttct ttggcgggga ccaaacggaa aagaccttgc ggggtataga
     1441 ggatgcagtg atagatatgg aggtgttgtc cagcaccaat gtgacacaat tggttaaaga
     1501 taagaaattg gccagaactt acatgaatgt gctggataat gaagaggaaa aagcaaggaa
     1561 actctcagtt cgtagtgccg atccacacat agtgacctca gtcaacaacc tgatatcacg
     1621 aatatctatg gcaaggtcgg ccttagctaa agcccaagct gagatgacat ctcgcccacg
     1681 cccggtggtc ataatgatgt gtggcccacc cggcatcgga aaaaccaagg ccgccgaaca
     1741 cctggccggc cgactggcaa atgaaattag accgggaggt aaggttggac ttgtgccccg
     1801 agagtctata gatcactggg atggatacca tggcgaggat gtcttactat gggatgacta
     1861 tggcatgtca aaaataacag aggactgtaa caagttacaa gccatagctg acaccgcacc
     1921 cctatcactt aattgtgaca ggatagagaa taaaggcatg caattttcct cagatgcaat
     1981 aattataacc actaatgccc ctggtccggc cccagtggac ttcgtcaatt tgggccctgt
     2041 gtgtaggcga gtggacttct tggtctattg ttctgcccct gaaattgagc aaatgagaag
     2101 aacccatcct ggtgatgcca atgccattaa ggacctatat aaaagggact attcacacct
     2161 aaaaatggaa ttggccccac aaggtggctt tgatagccag ggcaacacac catttggcaa
     2221 gggcatcatg aaacccacga cccttaatag gctactcatt caggcaacag cattagctat
     2281 ggagcggcag gatgaattcc ggctccaagg ggctgtctac aactttgatg aagacagggt
     2341 gtccgccttt acaagtctgg cccgtgctaa tggcttgggg cttttaagta tggcaacatt
     2401 aggtaaaaga ctcagaagtg tcaaatctat ggagggcctg cgtaatgcat tggtgggcta
     2461 caaaatagga gagtgtgata taatttggaa cactagagtg tattcaatta aaagtgatgg
     2521 tagtattgtc actatcaagg agaaacaaac cccaacttca cctcagtacc aggctattag
     2581 cacagccact cttgcactct ctagactgcg ggccgctaga gctcttgcat acgcctcctg
     2641 cctgcagagt gcagtgctgt caatacttca agtggctggc tctgccctgg tggtgagcag
     2701 ggctgtgaaa cgcatgtttg gcacgcgcac tgaacagcct atgttagaag gcaaacacag
     2761 agaacataac tgcagagtgc accgcgcaga ggcagctggc catggtccta ttgggcatga
     2821 tggagtcatt gaacgctatg gcctttgtga gagtgaacaa gaagaagaag gcgagcaaac
     2881 aattgagctg cccactgcca ataaagaggg taaaaacaag ggcaagacca aaaagggccg
     2941 tggacgaaag tccaatttca atgctttctc aagacgtggc ctcagtgatg aagagtatga
     3001 agaatacaaa aagatcagag aagaaaagag tggcaattac agcatccagg aatacctcga
     3061 ggatcgccaa cgctatgagg aagaacttgc tgaagtgcag gctggtgggg atggtggaat
     3121 tggtgagact gaggcagaga ttcgccatcg ggttttctat aaatcaaaat ccggcatgag
     3181 aaaacaacgc caagaagagc ggcgtcagct gggactcgtc agcggttctg agatccgcaa
     3241 gcgcaagccc atagactgga cccctcctaa gaatgattgg tcagaagaca ccagaactgt
     3301 caactatgat gaacacatta gctttgaagc ccctccctca atttggagta gggtggtgaa
     3361 gtttggtagt ggctggggtt tttgggtaag ctcaacagtg tttataacca caacccatgt
     3421 cataccacct ggtgctaaag aagtctttgg tgaagacctt agcaatgtgg ccatccacag
     3481 ggttggtgag ttcacccagt tccgtttctc caaaaagatg agacctgacc tcaccggtat
     3541 ggtcctggaa gagggctgcc cagagggaac agtatgcacc ataatgatca agagagactc
     3601 tggtgaactg ctgccgctcg ccgttcggat gggggcggtg gcgtcaatga agatccaagg
     3661 caagcttatg catggacaat caggaatgtt gctcaccggc gctaatgcta aaggcatgga
     3721 ccttggaact atacctggtg attgtggggc accctatgtc cacaagaggg gaaacgattg
     3781 ggtagtctgt ggagtacatg cagccgccac aaaatcaggc aacactgtgg tgtgtgctat
     3841 acagggtggc gatggtgaag ccacactgga gggcggcggt caaaacaagg gccactatgc
     3901 agggcacccg atactaaggt atgggaatgg cccttcactg tcaaccaaga caaaattttg
     3961 gaagtcaacc ccccagcctt tgccccctgg tacatatgag ccagcttacc ttggtggcag
     4021 agaccccaga gttgaggggg gcccatcctt gcaacaagtg ttaagggacc agttaaaacc
     4081 atttgccgag ccccgtggca gattgcctga agcgggcctg ttggaagctg cagttgaaac
     4141 ggtcaccaat gcaattgaac aagttatgga cacaccggtg gcatggagct acagtgatgc
     4201 ttgcatgtcc ctagataaga caaccagttc cggccacccc catcataaga agaaaaatga
     4261 tgattggaat ggaagttcat ttgtgaggga gttgggcgac caggcggcgc atgctaacag
     4321 catgtatgag cttggtaagt ccatgaaacc tgtgtacaca gcagccctga aggatgagct
     4381 agtcaagcca gacaaggtgt acacgaaaat caaaaagaga ctactttggg gcgcggacct
     4441 tggcaccgtc attcgcgctg ccagggcgtt tgggccattc tgtgaggcca taaaacccca
     4501 tgtaatcaaa ttgcccatca aagtaggtat gaatgccata gaggatggtc ctttgattta
     4561 tgcagagcat tctaagtata agtttcatta tgatgctgac tatacagcct gggactcaac
     4621 acaaaacagg gagatcatga tggaatcctt taacattatg tgtaagctca cagccaaccc
     4681 ctccttggcc gcggtagtgg cacaggatct actctcccca tctgaaatgg atgttggcga
     4741 ctatgtgatc agtgtcaaag atggtctgcc atctggcttc ccatgcactt cacaggtgaa
     4801 tagcattaac cactggatct taaccctatg tgcactgtca gaagtcaccg gcttgtcccc
     4861 agatgtgata caatcacaat cctacttctc attttatggt gatgatgaaa tagtctcaac
     4921 agacatagaa tttgacccaa taaggttgac acaaatactg aaggagtatg gtttgaagcc
     4981 cacaagacct gacaaaactg atggcccaat tattgtcaga cagcaggtcg atggtctggt
     5041 tttcctccga cgcaccatct ctaaagatgc cattggatac cagggacgac tcgaccgcaa
     5101 ctctattgaa agacagcttt ggtggactcg cggaccaaac cacgaggacc catttgagac
     5161 actggtccca cattcacaga gaaagatcca attaatatcc ctgttaggtg aagcagcact
     5221 ccatggtgaa aagttctaca ggaaaatagc tggcagggtc attcaagaag tcaaggaggg
     5281 ggggcttgaa atctacattc ctggttggca ggccatgttc cgctggatgc gattccatga
     5341 tctaagtttg tggacaggag accgcgatct cctgcccgat tatgtaaatg atgatggcgt
     5401 ctaaggacgc cccaacaaac atggatggca ccagtggtgc cggccagctg gtaccagagg
     5461 caaatacagc tgagcctata tcaatggagc ccgtggctgg ggcagcaaca gctgccgcaa
     5521 ccgctggcca agttaatatg attgacccct ggataatgaa taattatgtg caagcccctc
     5581 aaggtgaatt caccatatcg cctaacaaca caccaggtga tattttgttt gatctgcaat
     5641 taggccccca cctcaatcct ttcttgtccc atttagccca aatgtataat ggctgggttg
     5701 gcaacatgaa agtgaaagtt ttattggctg gcaatgcctt cacagctggt aaaataattg
     5761 ttagttgcat accccctggc tttgttgcac aaaacatttc tattgctcag gctactatgt
     5821 tcccccatgt catagctgat gttagggttt tggaacccat tgaggtgcca ctggaggatg
     5881 tgaggaatgt gttgttccac aacaacgaca acacaccaac catgaggttg gtgtgcatgc
     5941 tctacacccc cttgcgagcc agtggcagct cgtctggaac tgaccccttt gtgattgctg
     6001 ggcgtgtttt gacatgccca agtcctgatt ttagcttttt gtttttggtc ccccccaatg
     6061 tagaacaaaa gactaaaccc tttagtgtcc caaatcttcc attggatact ctttcaaatt
     6121 cgagagtccc ttctctaatc aaatcaatga tggtgtccag ggaccatggg cagatggttc
     6181 agtttcaaaa tggtagggtt accctagatg ggcaactgca aggcaccacg cccacatcag
     6241 ccagccagct gtgcaaaatc aggggcagtg tcttccatgc caatggtgga aatgggtaca
     6301 acctaacaga actggatggg agcccatacc atgcatttga aagccccgca ccaatagggt
     6361 ttccagatct aggtgagtgt gattggcaca tggaggcttc ccctaccacc caattcaata
     6421 ctggtgatgt tataaaacaa attaatgtca aacaagaatc agcatttgcc ccccaccttg
     6481 gtaccataca ggcagacggc ctaagtgatg tgagtgtcaa caccaacatg atagccaaat
     6541 tagggtgggt gtcacccgtc agtgatggac acaaaggaga tgtcgatccg tgggtcatcc
     6601 cacgctatgg gtcgactttg actgaggccg cccaattagc ccctccaata taccccccag
     6661 gttttggtga ggccattgtg tttttcatgt cagactttcc tattgcccat ggtaccaatg
     6721 gcttgagtgt gccttgcacc ataccccaag aatttgtcac ccattttgtc aatgaacagg
     6781 cccctactag aggggaagca gccctgctac attatttgga tcctgatact catagaaatc
     6841 ttggtgaatt taaattatat cctgatggct tcatgacgtg tgtgcctaac tccagtggca
     6901 ctggtccaca aactctccca attaatggtg tctttgtttt tgtgtcctgg gtttccagat
     6961 tctatcaatt aaagcctgtg ggaacagccg gcccggctcg taggcttggg attaggagat
     7021 cataatggct caagccatac ttggagccat agcagcaaca gcagctggca gtgctgttgg
     7081 tgctggtata caagctggaa ccgaagctgc cctacaacac caaaggttcc aacaagattt
     7141 gaccttacaa aagaattcct ttattcatga taaagagatg atgggcctac aggttgaggc
     7201 ttcgactgca ctcctccaaa acagtttggg tacaagatac aatatgttaa ccaaagcagg
     7261 gatgacatct gcagatgcgg cacgcatggt tgtgggggcg cctacaactc gtgtcattga
     7321 ttggaacggg actaggatcg ccgcacctat gtcaactgcg acgacactta ggtctggtgg
     7381 tttcatgacc gtaccaactg tttatagggg tggcaagaat aagcaatcaa ttggtggtgg
     7441 tttttctaat gtaaattatg atccctcagt ttcctcctct cggacttctc agtgggtttc
     7501 ttctcagaat tcaatgcgtt ccactttgga accattccac ccaggagccc taagaaccac
     7561 atgggttact ccacctgggt caacttctac ttcaacaatt tcaacagtct ctactgtgcc
     7621 aaaattcttt aatacagaaa ggttaccctt attcgcgaac aggggtaaat gattttgtaa
     7681 tatgaattag tgggcatcat attcaatttg gaatcaatta gatatttaga ttggcaga
//