Typing tool

Complete norovirus genomes

MN447470  GII.16
 GII.P16

Length: 7,579 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6701
ORF3: 6701..7498
LOCUS       MN447470                7579 bp    RNA     linear   VRL 17-SEP-2019
DEFINITION  Norovirus GII isolate Hu/US/2008/GII.16[P16]/US0366, complete
            genome.
ACCESSION   MN447470
VERSION     MN447470.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7579)
  AUTHORS   Gregoricus,N., Ames,J., Montmayeur,A.M., Tatusov,R.L., Chhabra,P.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7579
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="US0366"
                     /isolate="Hu/US/2008/GII.16[P16]/US0366"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="20-Oct-2008"
                     /note="Amplicon sequencing: first 35 nt does represent
                     primer sequence;
                     genotype: GII.16[P16]"
     gene            5..5098
                     /gene="ORF1"
     CDS             5..5098
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEP28114.1"
                     /translation="MKMASNDASAAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEPVIRYEVKSGISGLPELTTVPQPN
                     VTNTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     MAKVEMTPLSLYWRVVYTPQYLISPDTLKRLNGEAFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDIIGK
                     IKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGEYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRAIEDAVLDLEAIENNHMTALLKDKDSLATYMKTLDLEEEKARRLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAREV
                     ARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADTC
                     PLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKDAFKADFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKTM
                     EELKQAIKNVSIKRCQIIYNGSTFDLESDGKGKVLVEKVKSTSVQTNNELAGALHHLR
                     SARIRYYVKCVQEAVYSILQIAGAAFVTTRIARRMNIQELWSKPPLDQSEPEAKEEAP
                     KLEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLVTG
                     SEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPSL
                     FITSTHVIPAGITEAFGVPIKQVQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGTV
                     ATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDCG
                     CPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGPG
                     GAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPRG
                     RPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHARKNEFWNG
                     ETFIGKLADQASKANLMYEEGKHMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLST
                     MVRCARAFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDST
                     QQRAVLAAALEIMVRFSAEPQLAQTVAEDLLAPSVVDVGDFKISISEGLPSGVPCTSQ
                     WNSITHWLLTLCALSEVTNLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLREY
                     GLKPTRPDKTEGPLIISEDLDGLTFLRRTVSRDPAGWFGKLDQSSILRQMYWTRGPNH
                     EDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEPM
                     FRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2623
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2624..3022
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3023..3565
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3566..5095
                     /gene="ORF1"
                     /product="RdRp"
     gene            5079..6701
                     /gene="ORF2"
     CDS             5079..6701
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEP28115.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEILLNLELGPELNPYLAHLARMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPVDNLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQSDQRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFSVPVLTLNELTNSRFPVPIDAMYTSPNDSIVVQPQNGRATIDGELLGTT
                     QLIPSGICSFRGKITTHLSDDRHLWNIQVSNLNGTPFDPTDDVPAPLGMPDFSGQIFG
                     VVSQRDTGTNPANRAHDAVLATYSAKYTPKLGSVQIGTWDTEDLLERQPVKFTPVGLN
                     EIGQDKHFDQWVLPNYSGALGLNMHLAPAVSPLFPGERLLFFRSYIPLKGGHGDPFID
                     CLVPQEWIQHFYQESAPAQSSVALLRYVNPDTGRTLFEAKLHKEGFITVSSTENRPVI
                     VPPNGYFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6701..7498
                     /gene="ORF3"
     CDS             6701..7498
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEP28116.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMISIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGASRTTSFSGGFTNSTRARTVEPPKSSPPVQNTLISASRPSSTVSSSSTRST
                     VVTSSSTPPSIRSSVTRSSPRSVSQSVSPVSSRTGDWVQNQNRMLEPYLRGSLQTAFV
                     SPPSSKASSNGTVSTVPKEVLDSWTSAFNTRRQPLFAHLRRRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcgggtg aaggcttatt tacgaatatg tcttccaccc taaagaaagc
      121 cctcggggct cggcctaaac agcctgcccc gagggacaac tcacaaaagc ccccaagacc
      181 acctacgccc gagttggtta agaggatacc ccctcccccg cctaatggcg aagaagaacc
      241 agtcattagg tatgaggtta agagtggaat ctctggcctg cctgagctca cgacagttcc
      301 ccaaccgaat gtgaccaata cggcattcag tgtcccaccg ctgagcttga gagaaaacag
      361 ggaggccaag gaaccgttga ctggggcaat actagagatg tgggatggag agatatacca
      421 ctatggtttg tacgtggaga aaggcttagt gttgggtgtg cacaaaccac ctgcagctat
      481 aagtatggca aaggtggaaa tgacgccgct gtcattgtac tggcgtgtgg tgtacacccc
      541 tcaatatctc atctcccctg atactctcaa gaggctcaac ggggaggcat tcccttacac
      601 tgcctttgac aacaactgtt atgccttttg ctgctgggtg ttagatctta atgactcatg
      661 gctcagcaga aggatggtgc agagaacaac aggcttcttc agaccctacc aagagtggaa
      721 caggaaaccc ctacccacta tggatgactc aaagattaag aaggtggcaa acattttctt
      781 atgttcattg tccacgctgt tcaccagacc tataaaagac atcataggaa aaatcaaacc
      841 actaaatatc ttgaacattc tggcaacgtg tgactggacg ttcgccggaa ttgtagagtc
      901 tctaatatta cttgctgaac tctttggagt tttctggaca cccccagatg tgtctgctat
      961 gattgctccc ttacttggcg agtacgagct gcaagggcca gaagacatcg ccgttgagct
     1021 cgtacctgta gtgatgggag ggattggttt ggtgctagga ttcaccaagg agaaaattgg
     1081 caaaatgctg tcctcagcag catcaaccct tagggcttgc aaagaccttg gtgcttatgg
     1141 tttagagata ctcaaactgg tcatgaaatg gttcttccca aagaaagaag aggccaatga
     1201 actagccatg gtgagagcaa tagaggatgc tgtactagac ctcgaagcga tagaaaacaa
     1261 tcacatgaca gctctgctga aagataagga cagccttgca acctacatga aaacactgga
     1321 tctagaggaa gagaaagcca gaagattgtc cacaaaatct gcatcccctg acatagttgg
     1381 aacaatcaat gccctgctgg ctcgaatagc ggcggctaga tcgctagtcc atagggccaa
     1441 ggaggagcta tctagcagga tcaggccagt tgttgttatg atttctggca agccagggat
     1501 aggcaagacc cacctagcca gggaggtggc gagaaaggtg gcatccactc tcacgggaga
     1561 tcaaagagtc ggactcatac cgagaaacgg tgtggaccac tgggatgcat acaaaggtga
     1621 gagggtcgtg ttgtgggacg actacggcat gagcaacccc atccatgatg ctctgcgcat
     1681 acaggagttg gccgacacgt gtcccctcac cttaaattgt gacagaattg aaaataaggg
     1741 aaaagttttt gatagtgaag tcataataat cacaacaaac cttgccaatc cagctcccct
     1801 cgattatgtc aactttgagg cctgttccag aagaattgac ttcctggtgt acgccgaagc
     1861 accagaagtg gaaaaagcaa aacgagactt ccctggtcag ccagatatgt ggaaggacgc
     1921 cttcaaagca gacttttcgc atatcaagct acaacttgcg cctcagggcg gttttgacaa
     1981 gaacggcaat accccacatg gtaaaggagt gatgaagacc ctcactactg gttctctgat
     2041 tgcccgcgcg tcaggtttac tacatgagag gatggatgaa tttgaactcc agggccccac
     2101 aatcaccact ttcaatttcg accgaaacag aatcaccgcc tttagacaat tggctgcaga
     2161 aaacaagtat gggttggtgg acaccatgag ggttggcaat caattgaaag gggtgaaaac
     2221 catggaagaa ctcaagcaag caattaagaa tgtgtccatc aagaggtgcc agattatcta
     2281 taatggctcc acgttcgatc ttgagtctga tggtaagggc aaagttttag tggaaaaggt
     2341 caaaagcacc tctgttcaga ccaacaacga gctggccgga gccctgcatc acctcagaag
     2401 tgctcgaatt aggtattatg tcaaatgtgt gcaagaagca gtctactcca tcctgcaaat
     2461 tgccggcgct gcgttcgtta ccacacgcat tgcacgccgc atgaacatac aagaactttg
     2521 gtcaaagcca ccattagacc aaagtgaacc agaggctaaa gaagaggccc ccaagttaga
     2581 agatgatgag ttcatcatat cctccaaaga catcaaggag gaaggaaaga agggcaaaaa
     2641 caagactggc cgtggcaaga aacacacagc attctctagc aagggcttga gtgatgagga
     2701 gtatgacgag tacaagagaa taagagaaga gagaaatggg aagtactcta tagaggagta
     2761 tcttcaagac agagacaggt actatgagga gctcgccatc gccaaggcca cggaagaaga
     2821 cttttgcgag gaagaagaaa ttaaaatccg ccagagaatc tttcgcccca ctagaaaaca
     2881 aaggaaggaa gaaagggcca cgctaggact agtgactggt tcagaaatca gaaaaagaaa
     2941 ccctgatgac ttcaaaccta aagggaaatt gtgggccgac gacaacagaa gtgttgacta
     3001 caatgaaaaa ttggactttg aggccccccc aagcatatgg tctagaattg tgagctttgg
     3061 ttccggttgg ggcttctggg tgtcaccaag tctgttcata acatcaactc atgtaatccc
     3121 tgcgggcata acagaggcat ttggagtccc catcaaacaa gtccaagtcc acaaatcagg
     3181 tgagttttgc cggttcaggt tcccaaaacc aattagacca gatgtgacag gaatgattct
     3241 ggaagagggc gcgccagagg gcactgtggc aaccgtgcta atcaaacgcc ccaccggaga
     3301 actcatgccc ctcgcagcca gaatgggaac acacgcgacc atgaaaattc agggccgcat
     3361 ggttggcggg cagatgggta tgttgctcac tggttcaaat gctaagggta tggatttggg
     3421 aacaactcct ggtgattgtg gttgcccgta catctacaaa aggggcaatg actatatagt
     3481 cattggagtg cacacagcag cagcccgtgg tggaaatact gtcatctgcg ccacgcaggg
     3541 aagtgagggt gaggcgactc tcgagggtgg agacgacaaa ggaacatact gtggggcacc
     3601 cattctgggc cctggaggag caccaaaatt gagtaccaaa accaaattct ggaggtcatc
     3661 aaacacgccc ctcccaccag ggacatatga gcccgcttac cttggtggtc gtgacccgcg
     3721 tgtgaagggt gggccctctt tgcagcaagt tatgagagat cagttgaagc ccttcactga
     3781 gcccaggggt agacctccaa gacctagtgt actggaggca gctaaacaaa ccatcatcaa
     3841 cgtcctcgag caaaccttgg accccccaca aaagtggaca tacgcacagg cgtgtgcttc
     3901 gcttgataag accacctcta gtgggcaccc ccatcacgcc cgaaagaatg aattctggaa
     3961 tggtgagacc tttattggta agttggcaga ccaagcatca aaagcaaatt tgatgtatga
     4021 ggaagggaaa cacatgacac cagtgtacac agcagccctc aaggacgagt tggtcaagac
     4081 tgacaaaatc tatggtaaga tcaagaagag actgctttgg ggttctgact tgtccaccat
     4141 ggtccgatgt gctagggcct ttggtggact catggatgag atgaaggcac actgcatatc
     4201 actcccagtt cgagttggta tgaacatgaa tgaggatggc ccaataatat ttgagaagca
     4261 ttccagatat aagtaccatt atgatgctga ttactcccgc tgggattcaa cacaacaaag
     4321 ggctgttcta gcagcggcct tggagataat ggtcagattc tctgcagaac cacaactggc
     4381 gcaaacagtc gctgaagatc tgctggcccc tagtgtggta gatgtagggg acttcaaaat
     4441 ctcaataagt gaggggctcc cttctggtgt accatgcact tcccagtgga actccatcac
     4501 acattggctg ctgactctct gtgctttgtc tgaagtcacc aacctgtccc ctgatatcgt
     4561 gcaggcaaat tccatgttct cgttttacgg tgatgacgag attgtcagca ccgatataaa
     4621 attagaccct gaaaagttaa ccaccaaatt gagagaatat ggtctgaaac caacccgccc
     4681 agataaaact gagggacccc tgatcatcag cgaggatttg gacggactca ctttcctccg
     4741 gaggacagtt tctcgtgacc cagctggctg gtttggaaag ctagatcaaa gttcaatact
     4801 aagacagatg tattggacca gaggaccaaa ccatgaagac cccaatgaaa caatgatacc
     4861 ccactctcaa agacccatac agctcatggc actgcttggc gaggcttccc tccatggacc
     4921 ctctttctat agcaagatta gtaaattggt cataactgaa ctcaaagaag gtgggatgga
     4981 cttttacgtg ccaaggcagg aacccatgtt caggtggatg aggttttctg acttgagcac
     5041 gtgggagggc gatcgcaatc tggctcccag ttttgtgaat gaagatggcg tcgaatgacg
     5101 ccgctccatc taatgatggt gcagccggtc tcgtaccaga ggtcaacaac gagacaatgg
     5161 cactagagcc agttgcagga gcttcaattg ctgccccttt aactggtcaa aacaatgtaa
     5221 tagacccctg gattagatta aattttgtac aagcccccaa tggtgagttc acggtttccc
     5281 cccgaaactc gcctggtgaa attttgttaa atttggagtt agggcctgaa ttaaatccat
     5341 acttagccca tttagcaagg atgtataatg gttatgcagg tggggttgag gtgcaggtac
     5401 tgctggctgg aaatgcgttt acagcaggca aacttgtatt tgcagcaatc ccccctcatt
     5461 ttccagtaga taatttgagc cctggccaga ttactatgtt cccccatgtg attattgatg
     5521 ttagaacact tgaacctgtc ttgttaccat tacctgatgt tagaaataat ttctttcact
     5581 ataatcaaca gagtgatcag cgcatgagac ttgttgctat gctttatacc cctcttagat
     5641 ctaatggttc aggtgatgat gtcttcactg tgtcatgcag ggtcctaacc aggccatccc
     5701 ctgattttga ttttaattat ctggttcctc caacagttga atctaaaact aaacccttct
     5761 cagtcccagt gctaaccctt aatgagctga ccaactctcg ttttcctgtt ccgattgatg
     5821 ccatgtacac cagccctaat gactcaattg tggtccaacc tcaaaatgga agggcaacca
     5881 tagacggtga gttgcttggc accactcaac tcatacccag tggtatctgt tcatttaggg
     5941 gaaaaatcac aacacatttg tcagatgata ggcacttgtg gaacatccaa gtctccaatt
     6001 tgaatggcac tccgtttgac ccaacagacg acgtgcccgc accattgggt atgccagact
     6061 tctctgggca aatatttggg gtggttagtc aaagggacac aggcaccaac cccgcaaaca
     6121 gagctcatga cgctgttctt gcaacctaca gcgccaaata cacacctaag ctcggctcag
     6181 tccaaattgg aacatgggac accgaggatt tgcttgaaag acagcctgtc aagttcacgc
     6241 ccgttggtct caatgaaata gggcaagaca agcatttcga ccaatgggtg ttgccaaatt
     6301 attctggtgc cctgggactc aacatgcacc tggctcctgc tgtatcccca ctctttcccg
     6361 gagagagatt attgttcttt agatcatata tacctctaaa aggtggccat ggggacccat
     6421 ttattgattg tcttgtgcca caagagtgga tacaacattt ttaccaagaa tcagccccag
     6481 cacaatcctc ggtggctcta ctgaggtatg tgaatccaga cacaggtcgc actctatttg
     6541 aggccaaatt acacaaggaa gggtttatca ccgtctctag cacggaaaat aggcctgtga
     6601 ttgtcccccc aaatggttac tttaggtttg actcttgggt taaccaattt tactcattag
     6661 cccccatggg aactggcaat gggcgcagaa ggatgcagta atggctggag cttttatagc
     6721 aggacttgct ggtgacattg tcactaacgg cattggttcg cttgtgaacg ctggagccaa
     6781 tgctataaac caaaaagttg attttgaaaa taacaaacag ctacaacagg cctcttttaa
     6841 ccatgacaaa gagatgctgc aagcccaaat tcaagccacc aaacagctac aggctgacat
     6901 gatttcaatc agacaagggg ttttgaccgc gggcggcttc tcccctactg atgctgcaag
     6961 gggtgcagtc aacgcaccga tgacccaagt gctggactgg aatggaacta gacattgggc
     7021 ccctggagcc tcaagaacta ccagcttctc tggtgggttc accaattcta cccgtgccag
     7081 aacagttgag ccacctaaaa gttccccccc tgttcaaaat actttgatct ctgcttctag
     7141 acctagctct actgtctcat cttcctctac ccgttcgact gtggttacta gctcttctac
     7201 tcccccatct attaggtctt ctgtaactag aagttcaccc cgcagtgttt ctcaatctgt
     7261 ttctcctgtt tcttctcgca ctggtgattg ggtgcaaaac caaaatagaa tgctggagcc
     7321 atatctgagg gggtcgttgc aaacagcctt cgtgtcgccg ccctccagta aggcctctag
     7381 taatggcact gtctcaactg tgccaaaaga agttttggac tcctggacat ctgcgtttaa
     7441 tacccgcaga cagccgctct tcgctcacct ccgtcggagg ggggagtcac aagcttagtg
     7501 aaaagaatta gattttcttt ttctttcttt ccttttgttg aaaatcttat gtcttttaaa
     7561 aaaaaaaaaa aaaaaaaaa
//