Typing tool

Complete norovirus genomes

MN394542  GII.2
 GII.P16

Length: 7,532 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6709
ORF3: 6709..7488
LOCUS       MN394542                7532 bp    RNA     linear   VRL 04-SEP-2019
DEFINITION  Norovirus GII isolate 34 nonstructural polyprotein (ORF1), VP1
            (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN394542
VERSION     MN394542.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7532)
  AUTHORS   Huang,Z., Xiao,S. and Ou,X.
  TITLE     Mixed and recombinant norovirus infection in a outbreak in Changsha
            city, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7532)
  AUTHORS   Huang,Z., Xiao,S. and Ou,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2019) Microbiological laboratory, Changsha Center
            for Disease Control and Prevention, beside the liuyang river
            bridge, No. 509, wanjiali second north Road, Changsha, Hunan
            410000, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7532
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="34"
                     /isolation_source="anal swab"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China: Changsha"
                     /collection_date="01-Apr-2019"
                     /note="genotype: GII.P16-GII.2/34/Changsha/2019/CHN"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QEJ87972.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEVFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILFAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVSIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6709
                     /gene="ORF2"
     CDS             5081..6709
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QEJ87973.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     VISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6709..7488
                     /gene="ORF3"
     CDS             6709..7488
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QEJ87974.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSSATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaaa
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tacccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaat
      361 agggaggcca aggagccgct aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gctgacgccg ttgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaaccctc aggaggctca acggagaggt attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt acaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt attcactaga cccataaaag accttatagg aaaaatcaaa
      841 ccattgaaca tattgaatat cctggcaacg tgtgactgga cttttgccgg aatagtggag
      901 tctctgatat tatttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg ggggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gtaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcta tggtgagggc catagaggat gctgtactag accttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagataaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc caggaggttg tctacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaagaagagc tatctagcag gatgaggccg gtagttgtta tgatatctgg caaaccagga
     1501 ataggcaaga ctcatctggc cagggaggtg gcaagaaaag tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accacgaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagtaacc ctatccatga tgctcttcgc
     1681 atacaagaac tggctgatac gtgtcccctc accttgaatt gtgacagaat cgaaaataag
     1741 ggaaaagttt ttgacagtga agtcataata attacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggaggattg atttcctggt gtacgctgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc aaccagatat gtggaaggac
     1921 gctttcaagc cggacttttc gcacatcaag ctacagcttg caccccaagg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgtg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacgg cattcagaca attggctgca
     2161 gaaaacaagt atgggttggt ggataccatg agagttggca atcaattaaa aggggtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccagatcatc
     2281 tacggtggtt ccacgtatga ccttgaatct gacggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaataac gagttggctg gggctctgca ccatctcaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctattc catcatacag
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaactaga tcaaaatgaa tcagagacta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcattat atcttctaag gacatcaagg aagaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaacg gaaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga aatcaaaatc cgtcagagaa ttttccgtcc caccaggaaa
     2881 cagagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag gagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttc
     3061 ggttctggct ggggtttctg ggtgtcacca agccttttca taacatcaac tcatgtaatc
     3121 cccgcaggta taacagaagc atttggagtc tccatcaaac aaattcagat ccacaaatca
     3181 ggcgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagcttatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgctgctc actggatcaa atgctaaagg gatggactta
     3421 ggaacaactc ctggtgattg tggctgtcct tacatctaca aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ctgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcgccaaaa ttgagcacca aaaccaaatt ttggagatca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct atctcggtgg ccgcgatccg
     3721 cgtgttaagg gtgggccttc cctgcagcag gtgatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtgttggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgcc
     3901 tcacttgaca aaaccacctc cagcgggcac ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaactggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtac acagcagcac ttaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg cttatggacg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatacca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtgc tagcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga tctgctggcc cctagtgtag tagatgtagg agactttaaa
     4441 attacaataa atgaagggct tccttctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgatatc
     4561 atacaggcaa actccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctaaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgatcatc agtgaagatt tgaacggtct cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaata
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgagg accccaacga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aatttcgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctactgatg gtgcagccgg cctcgtgcca gaaagtaaca atgaggtcat
     5161 ggctcttgaa cccgtggctg gtgccgcctt ggcagccccg gtcaccggtc aaacaaatat
     5221 tatagaccct tggattagag caaattttgt ccaggccccc aatggtgaat tcacagtctc
     5281 tccccgaaat gcccctggtg aagtgctact gaatctagag ttgggtccag aattaaatcc
     5341 ttatctggca catttagcaa gaatgtacaa tgggtatgcc ggtgggatgg aggtgcaggt
     5401 catgttggct gggaacgcgt tcacagccgg caagttggtc ttcgccgccg tgccacccca
     5461 cttcccggtt gaaaacctta gcccacagca aataaccatg ttccctcatg tgatcataga
     5521 tgtgagaacc ctggaacctg ttttgttacc actccctgat gttaggaaca acttcttcca
     5581 ttataaccag aaagatgatc ccaagatgag aattgtggct atgctttata cccccctcag
     5641 gtctaatggt tcaggtgatg atgtgtttac agtctcctgt agagtgttga ctagaccttc
     5701 ccctgacttt gacttcacat acctggtgcc accaacagtg gagtctaaaa caaagccttt
     5761 caccctccca atcctcacac ttggggaact ttccaattct aggttcccag tgtccataga
     5821 ccagatgtat accagcccta atgaaattat atcagtgcag tgtcaaaatg gtaggtgcac
     5881 actggacggg gagctccaag ggacaacaca actccaagtt agcggcattt gtgctttcaa
     5941 aggtgaagtg accgcccact tgcatgacaa tgatcaccta tataatgtca ccatcacaaa
     6001 cttgaatggg tccccttttg atccctccga ggatatccct gcccctctgg gtgtgcctga
     6061 cttccaggga agggtttttg gtgtcatctc ccaaagagat aaacataata gtcctgggca
     6121 caatgaacca gcaaacaggg gacacgacgc tgtggtccct acttacacag cacagtacac
     6181 tccaaaactt ggacaaattc aaattggcac atggcaaact gacgacctta cagtcaacca
     6241 accagttaaa tttaccccag ttggactcaa tgacactgaa cacttcaacc aatgggtggt
     6301 ccctaggtat gctggtgccc taaacctcaa tacaaacctt gccccttctg ttgctccagt
     6361 attcccagga gagcgcctgc tcttcttcag atcatacatt cccctcaagg gcggttatgg
     6421 aagcccagcc attgattgcc tactaccaca agagtgggtg caacacttct atcaggaagc
     6481 agccccttca atgagtgagg tggccctcgt cagatacatc aacccggaca ctggtcgggc
     6541 actgtttgag gccaagctcc acagagctgg ttttatgaca gtctcgagca acaccagtgc
     6601 cccggtggtt gtgcctgcca acgggtactt cagatttgat tcttgggtga accaatttta
     6661 ttctctcgcc cccatgggaa ctgggaatgg gcgtaggagg gttcaataat ggctggagct
     6721 tttgtagctg gtcttgcagg ggacgtgctc agcaatgggc ttagttcatt aatcaatgca
     6781 ggtgctaatg caataaatca gagggcagaa tttgatttta atcagaagtt gcagcaaaat
     6841 tcttttaatc atgataagga gatgttgcag gctcagattc aggcaactaa gcagctgcag
     6901 gcagacatga tggctataaa acaaggggtc ttgaccgctg gcggcttttc ccctgctgat
     6961 gcagccagag gtgctgtgaa cgcgcccatg acacaggcgc tggattggaa tggcacaagg
     7021 tattgggcac caaactccat gaggaccacg tcttattctg gaaaattcac atcaaccgcc
     7081 ccagtgaggc aggctgactt ccagcacacc caaagccggc cttcgagtgg ctcctctgtg
     7141 tcttcctctg ccactcagtc ttcaaggcca actctgacca caaccactgg ttcctcacat
     7201 ggcacagcct catcaaattc aactcgcagt acaagcctct cccaatcaac ggtctccaga
     7261 gctacatcta ggactggtga gtgggttaga gatcaaaata gaaatttgga accctacatg
     7321 catggtgcct tacagacagc ctttgtcacc ccaccttcca gcagggcatc tgatgggaca
     7381 gtctcaaccg tccctaaagg tgttttggac tcctggacac ctgcgtttaa cacccgcagg
     7441 cagccgcttt ttgcacacct ccgtaagagg ggggagtcac aagcttagtg aaaaggtgaa
     7501 aatttattta ggatgaattg attttacctt tt
//