Typing tool

Complete norovirus genomes

MN308019  GII.4 Sydney
 GII.P31

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       MN308019                7512 bp    RNA     linear   VRL 29-JUN-2021
DEFINITION  Norovirus GII isolate 181_GII.Pe_GII.4_Araguaina nonstructural
            polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN308019
VERSION     MN308019.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da Costa,A.C., Tahmasebi,R., Milagres,F.A.P., Dos
            Santos Morais,V., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Rodrigues Teles,M.D.A., Cunha,M.S., Araujo,E.L.L., Gomez,M.M.,
            Deng,X., Delwart,E., Sabino,E.C., Leal,E. and Luchs,A.
  TITLE     Norovirus strains in patients with acute gastroenteritis in rural
            and low-income urban areas in northern Brazil
  JOURNAL   Arch Virol 166 (3), 905-913 (2021)
   PUBMED   33462673
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da-Costa,A.C., Leal,E.S., Tahmasebi,R.,
            Milagres,F.A.P., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Teles,Md.A.R., Sayao-Lobato,M.C.A.B., Chagas,R.T.,
            Santos-Abrao,Md.F.N., Alves-Soares,C.V.D., Cunha,M.S., Deng,X.,
            Delwart,E., Sabino,E.C. and Luchs,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2019) Institute of Tropical Medicine, University
            of Sao Paulo, Av Dr Eneas de Carvalho Aguiar 470, Sao Paulo, Sao
            Paulo 05403000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="181_GII.Pe_GII.4_Araguaina"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="06-Aug-2014"
                     /note="genotype: GII.Pe_GII.4"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QED42445.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRPLGARP
                     KQPPPKEIPPRPPRPPTPELGKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPYTLRSLHCDSFPYTAFYNSCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LVVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKALGAYGLEILKLVMKRLFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSCWRAVVVMISGRPGIGKTHLARHL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMRHPIQGALRLQELAYTS
                     PFTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDVDTMKGPALTTFNLENSPILAFRQLAAENKYGLMDTMKVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGSTYTLEADGRGSVKVDKVQSATVHFVNHLAGALHHLR
                     CARIRYYVKCVQEALYSMIQIAGAAFVTTRIAMRVNIQNLWSKPQVEDTEEMTSKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSDRTPHHWAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPEDFKPKGKPWADDDRRVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVS
                     PSLNTKLTHIIPHGAKEFFGVPIKQIQIHKSGELCRLRFPNPIGTDVAGMILEEGALG
                     GTVGALPICPPTGAPLNLSVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPIL
                     GPGSAPKLSTKTKFWRSSTTPLPPGTYVPAYLGGKDPRVKGGPSLQHVMRDQLKPFTE
                     PRGKPPRPTVLGDARKTIISVRGQTIVAPRKWSVAQACASLDKTSSCGQPQHMRKNDC
                     WNGGSVTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYAKIKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRDVLAAALEIMVKFSPEPHLGQVVADDLLSPSVMDVGDFQISISEGLPSGVPC
                     TSQWNSIAHWLLTLCALSDVRDRSRDFIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHADPFETMIPHSPRPIQLMSLLGEAALHGPAFYSQLCKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSGVNEDGVE"
     mat_peptide     1..990
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     991..2088
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2089..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6706
                     /gene="ORF2"
     CDS             5084..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QED42446.1"
                     /translation="MKMASNDAAPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSRSARKYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLLD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPSEEMSTGHSSGFVVQPQNDRCTTDGVLLGTT
                     QLSPVSNCTLRGDVPHITSSWSYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFSPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQCLLPSYSGRNTHNVHPAPAVAPTLPGEQLLFFRTTTPGCIGYPNMDLD
                     CLLPQEWMQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     gene            6706..7512
                     /gene="ORF3"
     CDS             6706..7512
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QED42447.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVELKNNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETCAARGAIN
                     APMTKALDWSGIRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     TSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEAQSRNLSPFMRGPHNI
                     YFVTPPDSRSPSHGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 ttgaaaatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcggcccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gagataccac ccagaccccc gcgaccaccc
      181 acaccagaat tgggcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaattatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccatcagc
      481 cttgccaagg tcgagctaac accgctctct ttgttctgga gacctgtata tactccccag
      541 tatctcatct ctccatacac tcttaggagt ttacattgtg actcattccc ctacactgca
      601 ttttacaaca gttgctacgc cttttgttgt tgggtattag acctaaacga ctcatggctg
      661 agcaggagaa tgattcagag aacaacaggt ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actctgtctt cactattcac cagacccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcttta
      901 atactcttag cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gccccattgc taggtgatta tgaactgcaa ggacctgagg accttgtagt ggagctggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aattggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag ctcttggtgc atacggattg
     1141 gaaatcttaa aattggtcat gaagcggctc ttcccaaaga aagaggaggc aaatgaactg
     1201 gctatggtga gatccatcga ggacgcagtg ctagatctcg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagctagaaa actctcaacc aaatccgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttttggcaag aatcgctgct gcgcgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gctgctggag agctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcatc ttgccaggca cctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgcgc caccccatcc agggtgccct taggttgcag
     1681 gagcttgctt acacatcccc cttcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgt attgacttcc tcgtgtacgc agaggcccct
     1861 gaggtggaga aggcgaagcg cgatttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatccg ggttactcca tgagaggcta gatgtggaca caatgaaagg cccggccctc
     2101 accactttca acttggaaaa cagcccaata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgaaagtt ggaaaacagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc gcgatcaaga agtgccagat agtgtacaat
     2281 ggtagcacct acacacttga ggccgatggc aggggtagtg tgaaagttga caaagtgcaa
     2341 agtgccactg tgcactttgt gaatcatcta gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcactgt attccatgat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatagcg atgcgcgtga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagatg accagcaaag atggttgcct aaaacccaaa
     2581 gatgatgaag aatttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtccg atcgtactcc tcatcactgg gccttttcaa gcaaagggct cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 tacctccagg acagagacag gtactacgag gaggtggtgg ccattgccag ggcaaccgaa
     2821 gaggacttct gtgaagaaga agaggccaaa atccggcaga gaatttttag accaacaagg
     2881 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaag
     2941 agaaatccag aagacttcaa acccaaggga aagccgtggg ctgatgatga cagaagagtt
     3001 gactacaatg agaaactcaa ctttgaggcc ccaccaagca tctggtcgcg gatagttaac
     3061 tttggttcag gctggggctt ctgggtctcc cccagtctga atacaaaatt aacccatatc
     3121 ataccccacg gtgcaaaaga gttcttcgga gtccctatca agcaaatcca gatacacaag
     3181 tcaggtgaat tgtgccgctt gagattcccg aacccaatcg gaacggacgt ggcgggcatg
     3241 attctagaag aaggtgcgct cgggggaacc gtaggagcac tgcccatttg ccctccaact
     3301 ggtgcgcccc tgaatctttc agttagaatg ggaacccatg caaccatgaa aattcagggg
     3361 cgcacagttg gagggcaaat gggcatgctc ctgacaggat ccaacgccaa gagtatggac
     3421 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3481 gtggtcatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccact
     3541 caggggagtg agggagaagc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3601 gcaccgatct tgggcccagg gagcgctccg aagctcagta ccaagactaa gttttggaga
     3661 tcatccacaa caccactccc acctggcacc tacgtaccag cctacctcgg tggcaaagac
     3721 cccagagtca aaggtggccc ttcactgcaa cacgttatga gggaccagct gaagccattc
     3781 acagaaccca gaggcaaacc accaaggcca actgtgttgg gagatgcaag gaaaaccatc
     3841 atcagtgtcc gtgggcaaac aattgttgca ccccgaaaat ggtcagttgc gcaagcttgc
     3901 gcatcccttg acaaaacctc ctcctgcgga caaccacaac acatgcggaa aaacgactgt
     3961 tggaatgggg ggtccgtcac gggaaaattg gctgatcaag cctccaaggc caacctaatg
     4021 tttgaagagg gaaagaacat gactccagtc tacacaggtg cacttaaaga tgagttggta
     4081 aagaccgata aagtttatgc taagatcaag aagaggctcc tgtggggttc agatctggcg
     4141 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcgcactgt
     4201 gtcacacttc ctgtcagagt tggcatgaac atgaatgagg atggccccat catctttgag
     4261 aagcactcca gatatagata ccactatgat gctgactatt cccggtggga ctcaacacaa
     4321 caaagggatg tgctagcagc agccctagaa atcatggtta agttctctcc tgaaccacac
     4381 ctgggccagg tagtagcaga cgacctcctt tcccctagcg taatggatgt aggtgacttt
     4441 caaatatcaa taagtgaggg tcttccctct ggggtacctt gtacctccca gtggaattcc
     4501 atcgcccact ggctcctcac tctttgtgca ctttctgatg tcagggacag gtcccgtgac
     4561 ttcattcagg ccaactccct tttctccttc tatggtgatg atgagattgt aagcacagac
     4621 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggct gaaaccaacc
     4681 cgccccgaca aaactgaagg accccttgtt atctctgaag acctggatgg cctgacattc
     4741 ctccggagga ctgtgacacg tgatccagct ggctggtttg gaaaattgga acagagttca
     4801 attctcaggc aaatgtactg gaccaggggt cccaaccatg cagatccatt tgaaacaatg
     4861 ataccacact ccccaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4921 ggcccggcat tctacagcca actctgcaaa ttagtcattg cagagttgaa ggaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcagat ggatgagatt ctcagatctc
     5041 agcacatggg agggcgatcg caatcttgct cccagtggtg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctgatg ggtccgctgc caacctcgtc ccagaggtca acaatgaggt
     5161 tatggctctg gagcccgttg ttggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaacaattt tgtacaagcc cctggtggag agttcacagt
     5281 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttgggcc ctgacctaaa
     5341 tccctaccta tcgcgttcgg ccagaaagta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaattctc gcggggaacg cgttcaccgc cgggaaggtc atatttgcag cagtcccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggtcact atgttccccc atatagtagt
     5521 agatgttagg caactagaac ctgtgttgat tcccttactc gatgttagga ataatttcta
     5581 tcattacaat caatcaaatg atcccactat taagttgata gcaatgttgt atacaccact
     5641 tagggctaat aacgctgggg atgatgtctt cacagtttct tgccgagttc tcacgagacc
     5701 atcccccgat tttgatttca tatttctagt gccacccaca gttgagtcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaagattcc ccattccttc
     5821 agaggagatg tcaacgggtc acagcagtgg ctttgttgtc caaccacaaa acgataggtg
     5881 cacgactgat ggcgtgctcc taggcaccac ccaactgtct cctgtcagca actgtacctt
     5941 acgaggagat gttccccaca tcacaagtag ctggagttac acgatgaatt tggtttctca
     6001 gaattggaac aattatgacc caacagaaga aatcccagcc cctctaggaa ctccagactt
     6061 tgtggggaag attcaaggtg tactcaccca aaccacaagg acagatggct caacgcgcgg
     6121 ccacaaagcc acagtgtaca ctgggagcgc cgatttttct ccaaaactgg gtagagttca
     6181 atttgaaact gacacagacc atgattttga agctaaccaa aacacaaagt tcaccccagt
     6241 tggtgtcatc caagatggta gcaccaccca ccgaaatgaa ccccaacagt gtttgctccc
     6301 aagttactca ggcagaaata ctcataatgt gcatccggcc cccgctgtag ccccgacttt
     6361 gccgggtgag caacttctct tcttcaggac caccacgccc ggatgcatcg ggtaccccaa
     6421 catggatttg gactgtctcc tcccccagga atggatgcag tacttctacc aagaggcagc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatt ccccccaatg gttattttag atttgattcc tgggttaacc agttctacac
     6661 gcttgccccc atgggaaatg gaacggggcg tagacgtgca gtataatggc tggagctttc
     6721 tttgctggat tggcatctga tgtccttggc tctggacttg gttcccttat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgagctt aaaaataaca gaaaattgca acaagcatcc
     6841 ttccaattta gcagcaatct acaacaggct tcctttcagc atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaagctacaa caggaaatga tgaaagttaa gcaggcaatg
     6961 ctcctagagg gtgggttctc tgagacgtgt gcagcccgcg gggcaatcaa cgcccccatg
     7021 acaaaagctt tggactggag cgggataagg tactgggctc ccgatgctag gactacaaca
     7081 tacaatgcag gccgcttctc cacccctcaa ccatcggggg cactgccagg aagagctaat
     7141 cttagggatg ctgtccctgc tcggggttcc tctagtaaat cttctacctc ttctattgct
     7201 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggt
     7261 accagtgtct cgagcctccc gtcaactgca aggactagga gctgggtgga ggctcagagt
     7321 aggaatttgt cacctttcat gagggggccc cacaacatat attttgtcac cccaccagat
     7381 agcagatccc ctagccacgg cacagtctca accgtgccta aagagatttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7501 tcacgggcgt aa
//