Typing tool

Complete norovirus genomes

MN308012  GII.4 Sydney
 GII.P31

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       MN308012                7512 bp    RNA     linear   VRL 29-JUN-2021
DEFINITION  Norovirus GII isolate 123_GII.Pe_GII.4_Araguaina nonstructural
            polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN308012
VERSION     MN308012.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da Costa,A.C., Tahmasebi,R., Milagres,F.A.P., Dos
            Santos Morais,V., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Rodrigues Teles,M.D.A., Cunha,M.S., Araujo,E.L.L., Gomez,M.M.,
            Deng,X., Delwart,E., Sabino,E.C., Leal,E. and Luchs,A.
  TITLE     Norovirus strains in patients with acute gastroenteritis in rural
            and low-income urban areas in northern Brazil
  JOURNAL   Arch Virol 166 (3), 905-913 (2021)
   PUBMED   33462673
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da-Costa,A.C., Leal,E.S., Tahmasebi,R.,
            Milagres,F.A.P., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Teles,Md.A.R., Sayao-Lobato,M.C.A.B., Chagas,R.T.,
            Santos-Abrao,Md.F.N., Alves-Soares,C.V.D., Cunha,M.S., Deng,X.,
            Delwart,E., Sabino,E.C. and Luchs,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2019) Institute of Tropical Medicine, University
            of Sao Paulo, Av Dr Eneas de Carvalho Aguiar 470, Sao Paulo, Sao
            Paulo 05403000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="123_GII.Pe_GII.4_Araguaina"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="31-Aug-2015"
                     /note="genotype: GII.Pe_GII.4"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QED42424.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGMFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LARVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGIFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLVDTMRVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSHRTPHHWAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLPVRDRYSSMELAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTGVTGMILEEGAPE
                     GTVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPIL
                     GPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     1..990
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     991..2088
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2089..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6706
                     /gene="ORF2"
     CDS             5084..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QED42425.1"
                     /translation="MKMASSDANPSDGSAANLVPEINNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSHNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6706..7512
                     /gene="ORF3"
     CDS             6706..7512
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QED42426.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSF
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRSLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 ttgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tatgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaataccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaattatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccatcagc
      481 cttgccaggg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ccccagacac tcttaggaga ctacatggag agtcattccc ctacactgca
      601 tttgacaaca attgctacgc cttttgttgc tgggtgttag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggc ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggacataa tagggaaatt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggaattttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaaa
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggttat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagtg ttagacctcg aggcaattga aaacaatcac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgcct cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaaggcc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggcc ttatcccacg caatggtgtc gaccattggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgacgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aatcatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgt attgatttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accaccttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tggtggacac aatgagagtt ggaaaacagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcgct caagaacatc gcgatcaaga agtgccaaat agtgtacaat
     2281 ggtggcacct acacacttga ggctgatggc aagggtagtg tgaaagttga caaagtgcaa
     2341 agcgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcagat actatgtcaa gtgcgtccag gaggcactgt attccatcat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagatg gccaacaaag atggttgcct aaaacccaaa
     2581 gatgatgagg agtttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtctc atcgtactcc tcatcactgg gccttttcaa gtaaaggact cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttccgg tcagagacag gtactcttct atggagttgg ccattgccag ggcaaccgaa
     2821 gaggacttct gtgaagaaga agaggccaaa atccggcaga gaattttcag accaacaagg
     2881 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaaa
     2941 agaaacccag aagacttcaa acccaaggga aagctgtggg ctgatgatga cagaagtgtt
     3001 gactacaatg agaaactcaa ctttgaggcc ccaccaagca tctggtcgcg gatagtcaac
     3061 tttggttcag gctggggctt ctgggtctcc cccagtctgt ttataacatc aacccatgtc
     3121 ataccccaag gtgcaaaaga gttcttcgga gtccctatca agcaaatcca aatacacaag
     3181 tcaggtgaat tctgccggtt gagattccca aagccaatca gaactggtgt gacgggcatg
     3241 attctagaag aaggtgcgcc cgaggggacc gtggccacac tgctcatcaa gagaccaact
     3301 ggagagctca tgcccctggc agccagaatg gggacccatg caaccatgaa aattcagggg
     3361 cgcacagttg gagggcaaat gggtatgctc ctgacaggat ccaacgccaa gagtatggac
     3421 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3481 gtggtcatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccacc
     3541 caggggagtg agggagaagc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3601 gcaccaatct tgggcccggg gagcgctccg aagctcagca ccaagactaa gttttggaga
     3661 tcatccacaa caccactccc acctggcacc tacgaaccag cctacctcgg tggcaaagac
     3721 cctagagtca aaggtggccc ttcattgcaa caagttatga gggaccagct gaagccattc
     3781 acagaaccca gaggcaaacc accaagacca aatgtgttgg aagctgccaa gaaaaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca ccccaaaaat ggtcatttgc gcaagcttgc
     3901 gcatcccttg acaaaaccac ctccagcggc cacccgcacc acatgcggaa aaacgactgt
     3961 tggaatgggg agtccttcac aggaaaattg gctgaccaag cctccaaggc caatctaatg
     4021 tttgaggagg gaaagaacat gactccagtc tacacaggtg cacttaaaga tgagttggta
     4081 aagaccgata aagtttatgg taaggtcaag aagaggcttc tgtggggttc agatctagcg
     4141 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcacactgt
     4201 gtcacacttc ctgtcagagt tggtatgaac atgaatgagg atggccccat catctttgag
     4261 aagcactcca gatatagata tcactatgat gctgattatt cccggtggga ctcaacacaa
     4321 caaagggatg tactagcagc agcactagaa atcatggtta agttctctcc agaaccacac
     4381 ctggcccaga tagttgcaga agacctcctt tcccctagcg tgatggatgt aggtgacttt
     4441 caaatatcaa taagtgaggg tctcccctct ggggtacctt gtacctccca gtggaattcc
     4501 atcgcccact ggctcctcac tctgtgtgca ctctctgaag tcacggacct gtcccctgat
     4561 atcattcagg ccaactccct tttctccttc tatggtgatg atgagattgt aagcacagat
     4621 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggct gaaaccaacc
     4681 cgccccgaca aaactgaagg accccttgtt atctctgaag acctggatgg cctgacattc
     4741 ctccggagaa ctgtgacccg tgatccagct ggctggtttg gaaaattgga gcaaagttca
     4801 attctcaggc aaatgtactg gaccaggggt cccaaccatg aggacccatt tgaaacaatg
     4861 ataccacact cccaaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4921 ggcccggcat tctatagcaa aattagcaaa ttagtcattg cagagttgaa ggaaggtggc
     4981 atggattttt acgtacccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgccaac ccatctgatg ggtccgcagc caacctcgtc ccagagatca acaatgaggt
     5161 tatggctctg gagcccgttg taggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaataattt tgtacaagcc cctggtggag agttcacagt
     5281 gtcccctaga aacgctccag gtgaaatact atggagcgcg cccctgggcc ctgatctaaa
     5341 tccctaccta tcccatttgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaattctc gcggggaacg cgttcaccgc cgggaaggtc atatttgcag cagtcccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggtcact atgttccccc atatagtagt
     5521 ggatgttagg caactagaac ctgtgttgat tcccttaccc gatgttagga ataatttcta
     5581 ccattacaat caatcaaatg accccaccat taagttgata gcaatgttgt atacaccact
     5641 tagggctaat aatgctgggg atgatgtctt cacagtttcc tgccgagttc tcacgagacc
     5701 gtcccccgat tttgatttca tatttctagt gccacccaca gttgagtcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaagattcc ccattccttt
     5821 ggaaaagttg ttcacgggtc ccagcagtgc ctttgttgtc caaccacaaa acggcaggtg
     5881 cacgactgat ggcgtgctcc taggcaccac ccaactgtct cctgtcaaca tctgcacctt
     5941 cagaggagat gtcacccata tcacaggtag tcataactac acaatgaatt tggcttctca
     6001 aaattggagc aattatgacc caacagaaga aatcccagcc cctctaggaa ctccagattt
     6061 tgtggggaag atccagggcg tgctcaccca aaccacaagg acagatggct caacacgcgg
     6121 ccacaaagcc acagtgtaca ctgggagcgc cgactttgct ccaaaactgg gtagagttca
     6181 atttgaaact gacacagacc atgattttga agccaaccaa aacacaaagt tcaccccagt
     6241 tggtgtcatc caagatggtg gcaccaccca ccgaaatgaa ccccaacagt gggtgctccc
     6301 aagttactca ggcagaaata ctcccaatgt gcatctggcc cccgctgtag cccccacttt
     6361 tccgggtgag caacttctct tcttcagatc caccatgccc ggatgcagcg ggtaccccaa
     6421 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aagaggcggc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatt ccccccaatg gttattttag gtttgattcc tgggtcaacc agttttacac
     6661 gcttgccccc atgggaaatg gaacggggcg tagacgtgca ctataatggc tggagctttc
     6721 tttgctggat tggcatctga tgtccttggc tctggacttg gttcccttat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgagttt gaaaataaca gaaaattgca acaggcatcc
     6841 ttccaattta gcagcaatct acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaggctacaa caggaaatga tgaaagttaa gcaggcaatg
     6961 ctcctagagg gtgggttctc tgagacagat gcagcccgcg gggcaatcaa cgcccccatg
     7021 acaaaagctt tggactggag cgggacaagg tactgggctc ccgatgctag gactacaaca
     7081 tacaatgcag gccgcttttc cacccctcaa ccatcggggg cactgccagg aagagctaat
     7141 ctcagggatg ctgtccctgc tcggggttcc tccagtaagt cttttaattc ttccactgct
     7201 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggc
     7261 accagtgtct cgagcttccc gtcaactgca aggactagga gctgggttga ggatcaaagt
     7321 aggagtttgt cacctttcat gaggggggcc cacaacatat cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccta aagagatttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7501 tcacgggcgt aa
//