Typing tool

Complete norovirus genomes

MN308008  GII.4 Sydney
 GII.P31

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       MN308008                7512 bp    RNA     linear   VRL 29-JUN-2021
DEFINITION  Norovirus GII isolate 083_GII.Pe_GII.4_Barra do Ouro nonstructural
            polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN308008
VERSION     MN308008.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da Costa,A.C., Tahmasebi,R., Milagres,F.A.P., Dos
            Santos Morais,V., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Rodrigues Teles,M.D.A., Cunha,M.S., Araujo,E.L.L., Gomez,M.M.,
            Deng,X., Delwart,E., Sabino,E.C., Leal,E. and Luchs,A.
  TITLE     Norovirus strains in patients with acute gastroenteritis in rural
            and low-income urban areas in northern Brazil
  JOURNAL   Arch Virol 166 (3), 905-913 (2021)
   PUBMED   33462673
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da-Costa,A.C., Leal,E.S., Tahmasebi,R.,
            Milagres,F.A.P., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Teles,Md.A.R., Sayao-Lobato,M.C.A.B., Chagas,R.T.,
            Santos-Abrao,Md.F.N., Alves-Soares,C.V.D., Cunha,M.S., Deng,X.,
            Delwart,E., Sabino,E.C. and Luchs,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2019) Institute of Tropical Medicine, University
            of Sao Paulo, Av Dr Eneas de Carvalho Aguiar 470, Sao Paulo, Sao
            Paulo 05403000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="083_GII.Pe_GII.4_Barra do Ouro"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="11-Mar-2013"
                     /note="genotype: GII.Pe_GII.4"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QED42412.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LVVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLMDTMKVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGSTYTLEADGRGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMTSKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSHRTPHHWAFASKGLSDEEYDEYKRIREERNG
                     KYSIEEYLPVRDRYSSMELAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPHGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPE
                     GTVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPIL
                     GPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYAKIKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRDVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFQISISEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSQLSKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSMWEGDRNLAPSFVNEDGVE"
     mat_peptide     1..990
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     991..2088
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2089..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6706
                     /gene="ORF2"
     CDS             5084..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QED42413.1"
                     /translation="MKMASSDVNPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     gene            6706..7512
                     /gene="ORF3"
     CDS             6706..7512
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QED42414.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 ttgaagatgg cgtctaacga cgcttccgct gccgctgtcg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gagataccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaattatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccatcagc
      481 cttgccaagg tcgagctaac accgctctct ttgttctgga gacctgtata cactccccag
      541 tatctcatct ctccagacac tcttaggaga ttacatggag agtcattccc ctacactgca
      601 tttgacaaca attgctacgc cttttgttgt tgggtattag acctaaacga ctcatggctg
      661 agcaggagaa tgattcagag aacaacaggt ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcttta
      901 atactcttag cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactacaa ggacctgagg accttgtagt ggagctggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aattggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggattg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaggc aaatgaactg
     1201 gctatggtga gatccatcga ggacgcagtg ctagaccttg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagctagaaa actctcaacc aaatccgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttttggcaag aatcgctgct gcgcgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcatc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgt attgacttcc tcgtgtacgc agaggcccct
     1861 gaggtggaga aggcgaagcg cgatttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtcg ctggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accactttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgaaagtt ggaaaacagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc gcgatcaaga agtgccagat agtgtacaat
     2281 ggtagcacct acacacttga ggccgatggc aggggtagtg tgaaagttga caaagtgcag
     2341 agtgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcgctgt attccatcat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagatg accagcaaag atggttgcct aaaacccaaa
     2581 gatgatgaag aatttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtctc atcgtactcc tcatcactgg gcctttgcaa gcaaagggct cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttccgg tcagagacag gtactcttct atggagttgg ccattgccag ggcaaccgaa
     2821 gaggacttct gtgaagaaga agaggccaaa atccggcaga gaatttttag accaacaagg
     2881 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaag
     2941 agaaatccag aagacttcaa acccaaggga aagctgtggg ctgatgatga cagaagtgtt
     3001 gactacaatg agaaactcaa ctttgaggcc ccaccaagca tctggtcgcg gatagttaac
     3061 tttggttcag gctggggctt ctgggtctcc cccagtctgt ttataacatc aacccatgtc
     3121 ataccccacg gtgcaaaaga gttcttcgga gtccctatca agcaaatcca gatacacaaa
     3181 tcaggtgaat tctgccggtt gagattccca aagccaatca gaactgatgt gacgggcatg
     3241 attctagaag aaggtgcgcc cgagggaacc gtggccacac tgctcatcaa gaggccaact
     3301 ggagagctca tgcctctggc agccagaatg ggaacccatg caaccatgaa aattcagggg
     3361 cgcacagttg gagggcaaat gggcatgctc ctgacaggat ccaacgccaa gagtatggac
     3421 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3481 gtggtcatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccact
     3541 caggggagtg agggagaagc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3601 gcaccgatct tgggcccagg gagcgctccg aagctcagta ccaagactaa gttttggaga
     3661 tcatccacaa caccactccc acctggcacc tacgaaccag cctacctcgg tggcaaagac
     3721 cccagagtca aaggtggccc ttcactgcaa caagttatga gggaccagct aaagccattc
     3781 acagaaccca gaggcaaacc accaaggcca aatgtgttgg aagctgccaa gaaaaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca ccccaaaaat ggtcatttgc gcaagcttgc
     3901 gcatcccttg acaaaaccac ctccagcggc cacccgcacc acatgcggaa aaacgattgt
     3961 tggaatgggg agtccttcac gggaaaattg gctgatcaag cctccaaggc caacctaatg
     4021 tttgaagagg gaaagaacat gactccagtc tacacaggtg cacttaaaga tgagttggta
     4081 aagaccgata aagtttatgc taagatcaag aagaggctcc tgtggggttc agatctggcg
     4141 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcgcactgt
     4201 gtcacacttc ctgtcagagt tggcatgaac atgaatgagg atggccccat catctttgag
     4261 aagcactcca gatatagata tcactatgat gctgactatt cccggtggga ctcaacacaa
     4321 caaagggatg tgctagcagc agcactagaa atcatggtta agttctctcc agaaccacac
     4381 ctggcccagg tagttgcaga agacctcctt tcccctagcg taatggatgt aggtgacttt
     4441 caaatatcaa taagtgaggg tcttccctct ggggtacctt gtacctccca gtggaattcc
     4501 atcgcccact ggctcctcac tctttgtgca ctttctgaag tcacggacct gtcccctgac
     4561 atcattcagg ccaactccct tttctccttc tatggtgatg atgagattgt aagcacagac
     4621 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggct gaaaccaacc
     4681 cgccccgaca aaactgaagg accccttgtt atctctgaag acctggatgg cctgacattc
     4741 ctccggagga ctgtgacccg tgatccagct ggttggtttg gaaaactgga acagagttca
     4801 attctcagac aaatgtactg gaccaggggt cccaatcatg aagatccatt tgaaacaatg
     4861 ataccacact cccaaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4921 ggcccggcat tttatagcca actcagcaaa ttagtcattg cagagttgaa ggaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agcatgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgtcaac ccatctgatg ggtccgcagc caacctcgtc ccagaggtca acaatgaggt
     5161 tatggctctg gagcccgttg ttggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaacaattt tgtacaagcc cctggtggag agttcacagt
     5281 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttgggcc ctgacctaaa
     5341 tccctaccta tcccatttgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaattctc gcggggaacg cgttcaccgc cgggaagatc atatttgcag cagtcccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggtcact atgttccccc atatagtagt
     5521 agatgttagg caactagaac ctgtgttgat tcccttaccc gatgttagga ataatttcta
     5581 tcattataat caatcaaatg atcccactat taagttgata gcaatgttgt atacaccact
     5641 tagggctaat aacgctgggg atgatgtctt cacagtttct tgccgagttc tcacgagacc
     5701 atcccccgat tttgatttca tatttctagt gccacccaca gttgagtcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaagattcc ccattccttt
     5821 ggaaaagttg ttcacgggtc ccagcagtgc ctttgttgtc caaccacaaa acggcaggtg
     5881 cacgactgat ggcgtgctcc taggcaccac ccaactgtct cctgtcaaca tctgtacctt
     5941 cagaggagat gtcacccata tcacaggtag tcgtaactac acaatgaatt tggcgtctca
     6001 aaattggaac aattatgacc caacagaaga aatcccagcc cctctaggaa ctccagactt
     6061 tgtggggaag attcaaggtg tactcaccca aaccacaagg acagatggct caacacgcgg
     6121 tcacaaagcc acagtgtaca ctgggagcgc cgactttgct ccaaaactgg gtagagtaca
     6181 atttgaaact gacacagacc atgattttga agctaaccaa aacacaaagt tcaccccagt
     6241 cggtgtcatc caagatggtg gcaccaccca ccgaaatgaa ccccaacagt gggtgctccc
     6301 aagttactca ggcagaaata ctcataatgt gcatctggcc cccgctgtag cccccacttt
     6361 tccgggtgag caacttctct tctttagatc caccatgccc ggatgcagcg ggtaccccaa
     6421 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aagaggcagc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatt ccccccaatg gttattttag atttgattcc tgggttaacc agttctacac
     6661 gcttgccccc atgggaaatg gaacggggcg tagacgtgca gtataatggc tggagctttc
     6721 tttgctggat tggcatctga tgtccttggc tctggacttg gttcccttat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgagttt gaaaataaca gaaaattgca acaagcatcc
     6841 ttccaattta gcagcaatct acaacaggct tcctttcagc atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaagctacaa caggaaatga tgaaagttaa gcaggcaatg
     6961 ctcctagagg gtgggttctc tgagacagac gcagcccgcg gggcaatcaa cgcccccatg
     7021 acaaaagctt tggactggag cgggacaagg tactgggctc ccgatgctag gactacaaca
     7081 tacaatgcag gccgcttctc cacccctcaa ccatcggggg cactgccagg aagagctaat
     7141 cttagggatg ctgtccctgc tcggggttcc tctagtaaat cttctaactc ttctattgct
     7201 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggt
     7261 accagtgtct cgagcctccc gtcaactgca aggactagga gctgggttga ggatcagagt
     7321 aggaatttgt cacctttcat gaggggggcc cacaacatat cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccta aagaggtttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7501 tcacgggtgt aa
//