Typing tool

Complete norovirus genomes

MN307998  GII.4 Sydney
 GII.P31

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       MN307998                7512 bp    RNA     linear   VRL 29-JUN-2021
DEFINITION  Norovirus GII isolate 047_GII.Pe_GII.4_Santa Fe do Araguaia
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MN307998
VERSION     MN307998.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da Costa,A.C., Tahmasebi,R., Milagres,F.A.P., Dos
            Santos Morais,V., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Rodrigues Teles,M.D.A., Cunha,M.S., Araujo,E.L.L., Gomez,M.M.,
            Deng,X., Delwart,E., Sabino,E.C., Leal,E. and Luchs,A.
  TITLE     Norovirus strains in patients with acute gastroenteritis in rural
            and low-income urban areas in northern Brazil
  JOURNAL   Arch Virol 166 (3), 905-913 (2021)
   PUBMED   33462673
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da-Costa,A.C., Leal,E.S., Tahmasebi,R.,
            Milagres,F.A.P., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Teles,Md.A.R., Sayao-Lobato,M.C.A.B., Chagas,R.T.,
            Santos-Abrao,Md.F.N., Alves-Soares,C.V.D., Cunha,M.S., Deng,X.,
            Delwart,E., Sabino,E.C. and Luchs,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2019) Institute of Tropical Medicine, University
            of Sao Paulo, Av Dr Eneas de Carvalho Aguiar 470, Sao Paulo, Sao
            Paulo 05403000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="047_GII.Pe_GII.4_Santa Fe do Araguaia"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="23-Apr-2014"
                     /note="genotype: GII.Pe_GII.4"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QED42382.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEVPPRPPRPPTPELVKKIPPPPPNGEEELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISAQPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRTGPHHWDAYKGERVVLWDDYGMSNHISFALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRKPILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LQPKDDEEFVVSSDDIKTEGRKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPE
                     GTVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVAIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPIL
                     GPGSAPKLSTKTKLRRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTE
                     PRGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     1..990
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     991..2088
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2089..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6706
                     /gene="ORF2"
     CDS             5084..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QED42383.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVLALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWCNVDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSAGFSPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6706..7512
                     /gene="ORF3"
     CDS             6706..7512
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QED42384.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAVLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSLTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 ttgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaagtaccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga ggaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggattgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccggacac tcttaggaga ttgcatggag agtcattccc ttacactgca
      601 tttgacaaca attgctacgc attttgttgt tgggtattag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggc ttctttaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaag ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggatataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgcaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctagaccttg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctttcca gcaggccgag acctgtcgtt gtgatgatat cggcacaacc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagattgcgg cctccctcac aggggaccag
     1561 cgtgtgggcc ttatcccacg cactggtccc caccattggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccacatct ctttcgccct caggttacag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattattacc accaatctgg ccaacccagc accactggat
     1801 tatgttaact ttgaagcgtg ctcgagacgc attgatttcc tcgtgtacgc tgaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaat
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ctactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccggccctc
     2101 accactttca actttgaccg caagcccata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgagagtt ggaaaacaac tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc gcgatcaaaa agtgccagat agtgtacaat
     2281 ggtggcacct acacacttga ggctgatggc aagggtagtg tgaaagttga caaagtgcaa
     2341 agtgccactg tgcagaccaa caatgaactt gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcactgt attccatcat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtct
     2521 aagccacagg tggaagacac agaagagatg gctaacaaag atggttgcct acaacccaaa
     2581 gatgatgaag agtttgtcgt ctcatccgac gacatcaaaa ctgagggcag aaagggaaag
     2641 aacaagtccg gccgtggcaa gaaacacaca gctttttcaa gtaaaggact cagtgatgag
     2701 gagtacgatg agtacaagag gatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttcagg acagagacag gtactacgag gaggaggtgg ccattgccag ggcaaccgaa
     2821 gaggacttct gtgaagaaga agaggccaaa atccggcaga gaattttcag gccaacaagg
     2881 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaag
     2941 agaaacccag aagacttcaa acccaaggga aagctgtggg ctgatgatga cagaagtgtt
     3001 gactacaatg agaaactcaa ctttgaggcc ccaccaagca tctggtcgcg gatagtcaac
     3061 tttggttcag gctggggctt ctgggtctcc cccagtctgt ttataacatc aacccatgtc
     3121 ataccccaag gtgcaaaaga gttcttcgga gtccctatca agcaaatcca gatacacaag
     3181 tcaggtgaat tctgccggtt gagattccca aagccaatca gaactgatgt gacgggcatg
     3241 attctagaag aaggtgcgcc cgaggggacc gtggccacac tgctcatcaa gagaccaact
     3301 ggagagctca tgcctctggc agccagaatg gggacccatg caaccatgaa aattcagggg
     3361 cgcacagttg gaggacaaat gggtatgctc ctgacaggat ccaatgccaa gagtatggac
     3421 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3481 gtggccatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccacc
     3541 caggggagtg agggagaagc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3601 gcaccaatcc tgggcccggg gagcgctccg aagctcagta ccaagactaa gcttcggaga
     3661 tcatccacaa caccactccc acctggcacc tacgaaccag cctacctcgg tggcaaagac
     3721 cctagagtca aaggtggtcc ttcattgcag caagttatga gggaccagct gaagccattc
     3781 acagaaccca gaggcaaacc gccaagacca aatgtattgg aagctgccaa gaaaaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca cctcaaaaat ggtcatttgc gcaagcttgc
     3901 gcatcccttg acaaaactac ctccagcggc cacccccacc acatgcggaa aaacgactgt
     3961 tggaatgggg agtccttcac gggaaagttg gctgatcaag cctccaaggc caatctaatg
     4021 tttgaagagg gaaagaacat gactccagtt tacacaggtg cacttaaaga tgagttggta
     4081 aagaccgata aagtttatgg taaggtcaag aagaggcttc tgtggggttc agatctggcg
     4141 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcacactgt
     4201 gtcacacttc ctgtcagagt tggtatgaac atgaatgagg atggccccat catctttgag
     4261 aagcactcca gatatagata tcactatgat gctgattatt cccggtggga ttcaacacaa
     4321 caaagggatg tgctagcagc agcactagaa atcatggtta agttctctcc agagccgcac
     4381 ctggcccaga tagttgcaga agacctcctc tcccctagcg tgatggatgt aggtgacttt
     4441 caaatatcaa taagtgaagg tctcccctct ggggtacctt gtacctccca gtggaattcc
     4501 atcgcccact ggctcctcac tctgtgtgca ctctctgaag tcacggacct gtcccctgat
     4561 atcattcagg ccaactccct tttctccttc tatggtgatg atgaaattgt aagcacagac
     4621 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggct gaaaccaacc
     4681 cgccccgaca aaactgaagg accccttgtt atctctgaag acctggatgg cctgacattc
     4741 ctccggagaa ctgtgacccg tgatccagct ggctggtttg gaaaattgga acaaagttca
     4801 attctcaggc aaatgtactg gaccaggggt cccaaccatg aagatccatt tgaaacaatg
     4861 ataccacact cccaaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4921 ggcccggcat tctatagcaa aattagcaaa ttagtcattg cagagttgaa ggaaggtggc
     4981 atggattttt acgtacccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agtacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgccaac ccatctgatg ggtccgcagc caacctcgtc ccagaggtca acaatgaggt
     5161 tttggctctg gagcccgttg taggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaataattt tgtacaagcc cctggtggag agtttacagt
     5281 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttgggcc ctgatctgaa
     5341 tccctaccta tcccatttgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaattctc gcggggaacg cgttcaccgc cgggaaggtc atatttgcag cagtcccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggtcact atgttccccc atatagtagt
     5521 agatgttagg caactagaac ctgtgttgat tcccttaccc gatgttagga ataatttcta
     5581 tcattacaat caatcaaatg accccactat taagttgata gcaatgttgt acacaccact
     5641 tagggctaat aatgctgggg atgacgtctt cacagtttct tgccgagttc tcacgagacc
     5701 gtcccccgat tttgatttca tatttctagt gccacccaca gttgagtcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaagattcc ccattccttt
     5821 ggaaaagttg ttcacgggtc ccagcagtgc ctttgttgtc caaccacaaa acggtaggtg
     5881 tacgactgat ggcgtgctcc taggcaccac ccaactgtcc cctgtcaaca tttgcacctt
     5941 cagaggagat gtcacccata tcacaggtag tcgcaactac acaatgaatt tggcttctca
     6001 gaattggtgc aatgttgacc caacagaaga aatcccagcc cctctaggaa ctccagattt
     6061 tgtggggaag attcaaggca tgctcaccca aaccacaagg acagatggct cgacacgcgg
     6121 ccacaaagcc acagtgtaca ctgggagcgc cggtttttct ccaaaactgg gtagagttca
     6181 atttgaaact gacacagacc atgattttga agctaaccaa aacacaaagt tcaccccagt
     6241 tggtgtcatc caagatggta gcaccactca ccgaaatgaa ccccaacagt gggtgctccc
     6301 aagttactca ggcagaaata ctcccaatgt gcatctggcc cctgctgtag cccccacttt
     6361 tccgggtgag caacttctct tcttcaggtc caccatgccc ggatgcagcg ggtaccctaa
     6421 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aagaggcagc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatc ccccccaatg gctattttag gtttgattcc tgggtcaacc agttttacac
     6661 gcttgccccc atgggaaatg gaacggggcg tagacgtgca ctataatggc tggagctttc
     6721 tttgctggat tggcatctga tgtccttggc tctggacttg gttcccttat caatgctggg
     6781 gctggggcca tcaaccaaaa agtcgagttt gaaaataaca gaaaattgca acaagcatcc
     6841 ttccaattta gcagcaatct acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaggctacaa caggaaatga tgaaagttaa gcaggcagtg
     6961 ctcctagagg gtgggttctc tgagacagat gcagcccgcg gggcaatcaa cgcccccatg
     7021 acaaaagctt tggactggag cgggacaagg tactgggctc ccgatgctag gactacaaca
     7081 tacaatgcag gccgcttttc tacccctcaa ccatcagggg cactgccagg aagagctaat
     7141 cttagggatg ctgtccctgc tcggggttcc tccagcaagt cttctaactc tttaactgct
     7201 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggc
     7261 accagtgtct cgagcttccc gtcaactgca aggactagga gctgggttga ggatcaaagt
     7321 aggaatttgt cacctttcat gaggggggct cacaacatat cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccta aagagatttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7501 tcacgggcgt aa
//