Typing tool

Complete norovirus genomes

MN307997  GII.4 Sydney
 GII.P31

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       MN307997                7512 bp    RNA     linear   VRL 29-JUN-2021
DEFINITION  Norovirus GII isolate 032_GII.Pe_GII.4_Araguaina nonstructural
            polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN307997
VERSION     MN307997.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da Costa,A.C., Tahmasebi,R., Milagres,F.A.P., Dos
            Santos Morais,V., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Rodrigues Teles,M.D.A., Cunha,M.S., Araujo,E.L.L., Gomez,M.M.,
            Deng,X., Delwart,E., Sabino,E.C., Leal,E. and Luchs,A.
  TITLE     Norovirus strains in patients with acute gastroenteritis in rural
            and low-income urban areas in northern Brazil
  JOURNAL   Arch Virol 166 (3), 905-913 (2021)
   PUBMED   33462673
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Tinker,R.J., da-Costa,A.C., Leal,E.S., Tahmasebi,R.,
            Milagres,F.A.P., Pandey,R.P., Jose-Abrego,A., Brustulin,R.,
            Teles,Md.A.R., Sayao-Lobato,M.C.A.B., Chagas,R.T.,
            Santos-Abrao,Md.F.N., Alves-Soares,C.V.D., Cunha,M.S., Deng,X.,
            Delwart,E., Sabino,E.C. and Luchs,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2019) Institute of Tropical Medicine, University
            of Sao Paulo, Av Dr Eneas de Carvalho Aguiar 470, Sao Paulo, Sao
            Paulo 05403000, Brazil
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="032_GII.Pe_GII.4_Araguaina"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Brazil"
                     /collection_date="25-Apr-2014"
                     /note="genotype: GII.Pe_GII.4"
     gene            1..5103
                     /gene="ORF1"
     CDS             1..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QED42379.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVLSNMAVTFKRALGARP
                     KQPPPREIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSTKGGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEVNELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTLNCVHQPILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYDGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMTNKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSHRIPHHWAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYSSMEVAITRATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPE
                     GTVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPIL
                     GPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVEGGPSLQQVLRDQLKPFTE
                     PRGRPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKIKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRW
                     DSTQQRDVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFQISISEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     KEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSQLSKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     1..990
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     991..2088
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2089..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6706
                     /gene="ORF2"
     CDS             5084..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QED42380.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTSSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSHNYTMNLASQNWSNDDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFSPKLGRVQFETDTNHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     gene            6706..7512
                     /gene="ORF3"
     CDS             6706..7512
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QED42381.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPEARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPPTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 ttgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgctttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgagg gagataccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcaccaaagg tggcgtttcc ggattgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaagaga gagcagggac
      361 gccaaggagc cactaactgg aacaattatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtatg tggaacgggg tcttatactt ggtgtgcaca aaccaccggc agccatcagc
      481 cttgccaagg tcgagctagc accgctctct ttgttttgga gacctgtata caccccccag
      541 tatctcatct ctccggacac tcttaggaga ttgcatggag agtcattccc ttacactgca
      601 tttgacaaca attgctacgc cttttgttgt tgggtattag acctaaacga ctcatggtta
      661 agcaggagaa tgattcagag aacgacaggt ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatc aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta atattctggc tacatgtgat tggaccttcg caggcatagt ggaatcttta
      901 atactcttag cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta cgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aattggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagt aaatgaattg
     1201 gctatggtga gatccatcga ggacgcagtg ctggacctcg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt caccagatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgccgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctttcca gcaggccgag acctgtcgtt gtgatgatat cgggaaggcc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgcgtgggtc ttatcccacg caatggtgtc gatcactggg acgcatacaa gggcgaaaga
     1621 gttgtcttat gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact tcgaagcgtg ctcgagacgt attgacttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatgggaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcgtcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccggccctc
     2101 acaactctca actgtgtcca tcagcccata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgagagtt ggaaaacaac tcaaggatgt caagaccatg
     2221 tcagacctca aacaggcact caagaacatc gcgatcaaga agtgccagat agtgtacgat
     2281 ggtggcacct acacacttga ggccgatggc aagggtagtg tgaaagttga caaagtgcag
     2341 agtgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcaggt actatgttaa gtgcgtccag gaggcactgt attccatcat ccagatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtcc
     2521 aaaccacagg tggaagatac agaagagatg accaacaaag atggttgcct aaaacccaaa
     2581 gatgatgaag agtttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtctc atcgtattcc tcatcactgg gccttttcaa gcaaagggct cagtgatgag
     2701 gaatacgatg agtacaagag aattagagaa gaaaggaatg gtaagtattc catagaagag
     2761 taccttcagg acagagacag gtactcttct atggaagtgg ccattaccag agcaaccgaa
     2821 gaggacttct gtgaggaaga agaggccaaa atccggcaga gaatctttag accaacaagg
     2881 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaag
     2941 agaaacccag aagacttcaa acccaaggga aagctgtggg ctgatgatga cagaagtgtt
     3001 gactacaatg agaaactcaa ttttgaggcc ccaccaagca tctggtcgcg gatagtcaac
     3061 tttggttcag gctggggctt ctgggtctcc cccagtctgt ttataacatc aacccatgtc
     3121 ataccccaag gtgcaaaaga gttcttcgga gtccctatca agcaaatcca gatacacaaa
     3181 tcaggtgaat tctgccgatt gagattccca aagccaatca ggactgatgt gacgggcatg
     3241 atcctagaag aaggtgcgcc cgaggggacc gtggccacac tgctcatcaa gagaccaact
     3301 ggagagctca tgcctctggc agccagaatg gggacccatg caaccatgaa aattcagggg
     3361 cgcacagttg gagggcaaat gggtatgctc ctgacaggat ccaacgccaa gagcatggac
     3421 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3481 gtggtcatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccacc
     3541 caggggagtg agggagaggc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3601 gcaccaatct tgggcccagg gagcgctccg aagctcagta ccaagactaa gttttggaga
     3661 tcatccacaa cacctctacc acctggtaca tatgaaccag cctacctcgg tggcaaagac
     3721 cccagggttg aaggtggtcc atctttgcag caagtgttgc gagaccagct aaaaccattc
     3781 acagaaccca gaggcaggcc accaagacca aatgtgttgg aagctgccaa gaaaaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca ccccaaaaat ggtcatttgc gcaagcttgc
     3901 gcatcccttg acaaaaccac ctccagcggc cacccgcacc acatgcggaa aaacgattgt
     3961 tggaatgggg aatccttcac gggaaaattg gctgaccaag cctccaaggc caacctaatg
     4021 tttgaagagg gaaagaacat gactccagtc tatacaggtg cacttaagga tgagttggta
     4081 aagaccgata aagtttatgg taagatcaag aagaggcttc tgtggggttc agacctggcg
     4141 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcgcactgt
     4201 gtcacacttc ctgtcagagt tggtatgaac atgaatgagg atggccccat catctttgag
     4261 aagcactcca ggtatagata ccactatgat gctgattatt cccggtggga ctcaacacaa
     4321 caaagggatg tgctagcagc agcactagaa atcatggtta agttctctcc agaaccacac
     4381 ctggcccagg tagttgcaga ggacctcctt tcccctagtg tgatggatgt aggtgacttt
     4441 caaatatcaa taagtgaggg tcttccctct ggggtacctt gtacctccca gtggaattcc
     4501 atcgcccact ggctcctcac tctttgtgca ctctctgaag tcacggacct gtcccctgac
     4561 atcattcagg ccaactccct tttctccttc tatggtgatg atgagattgt gagcacagac
     4621 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggtt gaaaccaacc
     4681 cgccccgaca aaactgaggg accccttgtt atctctgaag acctggatgg cctgacattc
     4741 ctccggagaa ctgtgacccg tgatccggct ggctggtttg gaaaattgga acaaagttca
     4801 attctcagac aaatgtactg gaccaggggt cccaaccatg aagatccatt tgaaacaatg
     4861 ataccacact cccaaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4921 ggcccggcat tctatagcca actcagcaaa ttagtcattg cagagttgaa ggaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcaggt ggatgagatt ctcagatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgccaac ccatctgatg ggtccgcagc caacctcgtc ccagaggtca acaatgaggt
     5161 tatggctctg gagcccgttg ttggtgccgc cattgcggca cctgtagcgg gccagcaaaa
     5221 tgtaattgac ccctggatta gaaataattt tgtacaagcc cctggtggag agtttacagt
     5281 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttgggcc ctgatctaaa
     5341 tccctaccta tcccatctgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaattctc gcggggaacg cgttcaccgc cgggaaggtc atatttgcag cagttccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggttact atgttccccc atatagtagt
     5521 agatgttagg caactagaac ctgtgttgat tcctttaccc gatgttagga ataatttcta
     5581 tcattataat caatcaaatg accccaccat taagttgata gcaatgttgt atacaccact
     5641 tagggctaat aatgctgggg atgatgtctt cacagtttct tgccgggtcc tcacgagacc
     5701 atcccccgat tttgatttca tatttctagt gccacccaca gttgaatcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccagt tcaagattcc ccattccttt
     5821 ggaaaagttg ttcacgggtc ccagcagtgc ctttgttgtc caaccacaaa acggcaggtg
     5881 cacgactgac ggcgtgctcc taggcaccac ccaactgtct cctgtcaaca tctgtacctt
     5941 cagaggagat gtcacccaca tcacaggtag tcataactac acaatgaatt tggcttctca
     6001 gaattggagc aatgatgacc caacagaaga aatcccagcc cctctaggaa ctccagactt
     6061 tgtggggaag attcaaggcg tgctcactca aaccacaagg acagatggct caacacgcgg
     6121 ccacaaagcc acagtgtaca ctgggagcgc cgacttttct ccaaaactgg gtagagttca
     6181 atttgaaact gacacaaacc atgattttga agccaaccaa aacacaaagt tcaccccagt
     6241 cggtgtcatc caagatggta gcaccactca ccgaaatgaa ccccagcagt gggtgctccc
     6301 aagttactca ggcagaaata ctcataatgt gcatctggcc cccgctgtag ctcccacttt
     6361 tccgggtgag caacttctct tcttcagatc caccatgccc ggatgcagcg ggtaccccaa
     6421 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aagaggcagc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatt ccccccaatg gttattttag atttgattcc tgggtcaacc agttctacac
     6661 gcttgccccc atgggaaatg gaacggggcg tagacgtgca gtataatggc tggagctttc
     6721 tttgctggat tggcatctga tgtcctaggc tctggacttg gttcccttat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgatttt gaaaataaca gaaaattgca acaagcatcc
     6841 ttccaattta gcagcaattt acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaagctacaa caggaaatga tgaaagttaa gcaggcaatg
     6961 ctcctagagg gtgggttctc tgagacagat gcagcccgcg gggcaatcaa cgcccccatg
     7021 acaaaagctt tggactggag cgggacaagg tactgggcac ccgaagctag gactacaaca
     7081 tacaatgcag gccgcttttc cacccctcaa ccatcggggg cactgccagg aagagctaat
     7141 cttagggatg ctgtccctgc tcggggttcc tctagtaaat cttctaattc ttctactgct
     7201 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggc
     7261 accagtgtct cgagcctccc gccaactgca aggaccagga gctgggttga ggatcaaagt
     7321 aggaatttgt cacctttcat gaggggggcc cacaacatat cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccta aagaggtttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7501 tcacgcgcgt aa
//