Typing tool

Complete norovirus genomes

MN226991  GI.6
 GI.P11

Length: 7,633 | 3 CDS

ORF1: 4..5370
ORF2: 5354..6976
ORF3: 6976..7605
LOCUS       MN226991                7633 bp    RNA     linear   VRL 31-JUL-2019
DEFINITION  Norovirus GI isolate Hu/US/2018/GI.Pb-GI.6/CA-RGDS-1059
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MN226991
VERSION     MN226991.1
KEYWORDS    .
SOURCE      Norovirus GI
  ORGANISM  Norovirus GI
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7633)
  AUTHORS   Pan,C.-Y., Huynh,T., Castro,C.J., Marine,R.L., Ng,T.F. and
            Wadford,D.A.
  TITLE     Norovirus GI.Pb-GI.6 from a Long Term Care Facility Outbreak,
            California, 2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7633)
  AUTHORS   Pan,C.-Y., Huynh,T., Castro,C.J., Marine,R.L., Ng,T.F. and
            Wadford,D.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-2019) Viral and Rickettsial Disease Laboratory,
            California Department of Public Health, 850 Marina Bay Parkway,
            Richmond, CA 94804, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.6; Geneious v. R10
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7633
                     /organism="Norovirus GI"
                     /mol_type="genomic RNA"
                     /isolate="Hu/US/2018/GI.Pb-GI.6/CA-RGDS-1059"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122928"
                     /country="USA: CA"
                     /collection_date="31-Aug-2018"
                     /note="genotype: GI.Pb-GI.6"
     gene            4..5370
                     /gene="ORF1"
     CDS             4..5370
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QDQ72248.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFRGLGGGASPPNP
                     IKIKSTEMALGLIGKTTQETAGTNGLPPKQQRDRPPRTQEEVQYGMGWTERPMDQNVK
                     SWEELDTSTKGEILDSHKEWFDAGGLGPCTMPSTCEQAKDDSPPGEQVRWSVRDGVDL
                     GVNRLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQIMNLEDTWLQRRLITSGRFHHPSQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLNKLKPLNILSILSNCDWTFMGVVEMVVLLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRIAMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKPDFSHLRMELAPQGGFDNQGNTPFGKGVMKPTT
                     INRLLIQAVALTMERQDEFRLQGKMYDFDDDRVSAFTTMARDNGLGILSMASLGKKLR
                     GVTSMEGLKNALKGYRIGACTIKWQAKVYSLESDGNSVNIREEKNVLTQQQQSVCTAS
                     IALTRLRAARAVAYASCIQSAITSILQIAASALVVNRAVKRMFGTRTAALSLEGPPKE
                     HKCRVHQAKAAGKGPIGHDDVVDKYGLCETEEDEEVVQTEMPSATMEGKNKGKNKKGR
                     GRKNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSKKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNERINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGYPHHKKKNDDWNGTAFIRELGEQAAHANNMYEQGKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVIRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLKEYGLKPTRPDKSEGPIIVRKSVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKIQLISLLGEA
                     SLHGEKFYRKISSKVIQEVKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     mat_peptide     4..1200
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1201..2289
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2290..2886
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2887..3300
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3301..3843
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3844..5367
                     /gene="ORF1"
                     /product="RdRp"
     gene            5354..6976
                     /gene="ORF2"
     CDS             5354..6976
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QDQ72249.1"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNIPLKDLSNSRVPVPVQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGTPFIPLESPAPVGFPDLGGCDWHV
                     NFTFQAQNQDPSQSVTFATNDASFVPYLGSISPHNGGDFHTGDIIGSLGWISAPSDNS
                     QLNVWTIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPSQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASAARRLGLRRI"
     gene            6976..7605
                     /gene="ORF3"
     CDS             6976..7605
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QDQ72250.1"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDKEMLGYQVQASNALLAKNLNTRYALLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPASSATTLRSGGFMAVPIPLSSKTKQPVMSGQDNPNYAASSISRTASWVQSQN
                     SMRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFYGVFNTDRLPLFANRR"
ORIGIN      
        1 tgaatgatga tggcgtcgaa agacgtcgtt gcgactaatg ttgcaagcaa taacaatgct
       61 aacaacacta gtgctacatc tcgattttta tcgagattca ggggtttagg tggtggcgca
      121 agccccccta atcccataaa gattaaaagc acagaaatgg ccttgggttt gattggcaag
      181 acaacccaag agacggcagg gaccaatggc ctgccaccta aacagcaaag agaccgaccc
      241 cctaggactc aagaggaagt tcagtacggc atgggatgga ctgaacggcc tatggatcag
      301 aatgtcaagt catgggagga gcttgatacc tctaccaaag gggagatctt ggacagccac
      361 aaagaatggt tcgatgcagg tggtttgggc ccatgcacaa tgccctcaac ttgtgaacag
      421 gctaaagatg atagcccgcc tggtgagcag gtcagatggt cagtgcgtga tggagttgac
      481 cttggagtga atcgccttac aacggtgagt ggccccgagt ggaatctctg tcctttaccc
      541 cctattgatc taaggaatat ggaaccagct agtgaaccca ccattggaga catgatagag
      601 ttttatgaag gtcatatcta ccactactcc atatacatag gacagggaaa gacagttggt
      661 gtgcactccc cacaggcggc attctctgta gccagagtga ctatccaacc catagccgct
      721 tggtggaggg tctgctacat accccagccc aaacataggc tgagttacga ccagcttaag
      781 gagttggaaa atgaaccttg gccatatgca gctatcacca acaattgttt tgagttttgc
      841 tgtcaaatta tgaaccttga ggacacatgg ttgcagaggc gactaataac atcaggcaga
      901 tttcaccatc cttcccaatc ttggtcacaa cagacccccg aatttcagca ggatagcaag
      961 ctggaactgg tcagagatgc catactggcc gcggtgaatg gccttgtttc acaacctttt
     1021 aaaaatttct tgaataaact caagcccctt aacatcctaa gcatcttatc taactgtgat
     1081 tggactttta tgggggtggt tgaaatggtt gtactacttc ttgaactctt tggcgtgttc
     1141 tggaatccgc ccgatgtgtc taattttata gcatcccttc tccctgattt tcacctccag
     1201 gggccagaag acctagcccg ggatctggtg ccagtcattc ttggtggcat agggctagcc
     1261 attggattta ccagagacaa ggtcactaaa gtcatgaaaa gtgctgtaga tgggctccgg
     1321 gccgctacgc agttagggca atatggattg gaaatatttt cactcctcaa gaagtatttc
     1381 tttggcgggg atcagactga gcgaactctc aaaggcattg aagcagcagt catagatatg
     1441 gaggttttgt cctctacgtc agtaacacaa ctggtgagag acaagcaggc agctaaagct
     1501 tatatgaata tcctggataa tgaagaggaa aaagctagaa aactttctgc taagaatgct
     1561 gacccccatg tgatatcttc aacaaatgcc ctgatatcac gcatagccat ggctcgatcc
     1621 gctctggcta aggctcaagc tgagatgacc agtcgaatga ggccagttgt cattatgatg
     1681 tgtggacccc ctggaattgg aaagactaag gcagcagagc acttggcaaa acgcctggcc
     1741 aatgagatca gacctggcgg caaagtggga ctggtgccac gtgaggctgt tgaccactgg
     1801 gatggctacc atggtgagga ggtgatgcta tgggatgact atggcatgac aaagatacaa
     1861 gatgactgca acaagctcca ggctattgct gactctgccc cactcactct caattgtgat
     1921 aggattgaaa acaaggggat gcagtttgtg tcagacgcaa tagtcatcac caccaatgcc
     1981 ccaggacctg cccctgtgga cttcgtcaac ctcggccctg tgtgcagacg ggtcgacttc
     2041 ctagtctact gttccgcccc agaggtggag caaataagga gggttagccc tggtgacaca
     2101 tcagcgctta aagactgctt caaaccagat ttctcccatc tcaggatgga gttagctcct
     2161 caaggggggt ttgacaacca agggaacaca ccatttggca agggtgttat gaaaccaaca
     2221 actatcaata gactcctcat acaagctgtg gctcttacca tggagagaca ggatgagttc
     2281 cgactccagg gaaaaatgta tgattttgat gatgataggg tgtcagcctt taccaccatg
     2341 gcacgcgata atggattggg cattctgagt atggcgagcc taggcaagaa gctgcgtggt
     2401 gttacatcaa tggagggcct gaagaatgcc ttgaaggggt acagaattgg tgcgtgcaca
     2461 atcaagtggc aggctaaggt gtattcacta gaatcagatg gcaacagtgt taacattagg
     2521 gaggagaaga atgttttgac tcaacaacag cagtcggtgt gcactgcttc tattgcactc
     2581 acccgcctgc gggccgcgcg tgcggtagca tatgcgtcat gcatccaatc agccataacc
     2641 tccatactac aaatagctgc ctcagcccta gtggttaaca gagccgtaaa gagaatgttt
     2701 ggtacacgca ccgctgcctt atccctagag ggccccccca aagagcacaa gtgtagggtc
     2761 caccaggcta aggccgcagg gaaggggccc attggccatg atgacgtggt tgacaagtat
     2821 ggtctatgtg agactgagga ggatgaagag gtggtccaaa ccgagatgcc atctgccacc
     2881 atggaaggca agaataaagg taagaacaag aaagggcgtg gccgaaagaa taactataat
     2941 gccttttccc gtagagggct caatgatgaa gagtatgagg agtacaagaa aatacgggaa
     3001 gagaagggtg gaaattacag cattcaggag tacctagaag atagacaaag gtatgaagag
     3061 gagcttgctg aggttcaagc aggtggagat ggagggatcg gcgaaaccga aatggaaatt
     3121 cgccatagag tgttctacaa gtccaagagt aagaagcacc accaggaaga acggcgccaa
     3181 ctaggattag tcacaggttc tgacatccgt aaaaggaaac caattgactg gaccccccct
     3241 aaatcagcat gggcagatga tgagcgcgaa gtggactaca atgagagaat caactttgag
     3301 gcgcccccca ccttatggag ccgagtcaca aaatttgggt ctgggtgggg cttttgggtt
     3361 agtcccacag tcttcataac cacaacacac gtcataccaa ccagtgcaaa agagttcttt
     3421 ggtgaacccc tcaccagtat agccattcat agggctggag aattcaccct cttcaggttc
     3481 tctaagaaaa tcaggcctga tctcacgggc atgattcttg aggaaggctg cccagagggt
     3541 acggtgtgct cagtgttaat aaaaagggac tccggtgagc tattaccatt ggctgtaaga
     3601 atgggcgcaa tagcatcaat gcgcatacag ggccgccttg tccatggcca gtctggtatg
     3661 ttgctcactg gggcgaatgc taagggcatg gaccttggaa ctatcccagg agattgtgga
     3721 gctccctatg tctataagag agcaaatgac tgggtggttt gtggtgtgca tgctgctgcc
     3781 actaaatcag gcaacacggt agtgtgtgcc gtccaagcta gtgaaggaga aaccacactg
     3841 gaggggggtg ataaaggtca ctatgctggg catgagataa ttaagcatgg atgtgggcca
     3901 gccttatcaa ccaaaacaaa gttctggaag tcgtcccctg aaccactacc ccctggagta
     3961 tatgaacctg catacctcgg tggccgggac ccaagagtga gtggtggccc ctcgctccaa
     4021 caggtgttgc gggaccaatt aaagccattt gctgaaccac gggggcgtat gccagagcca
     4081 ggtctcctgg aggccgcagt tgagactgtg acctcatcac tggagcaggt tatggatacc
     4141 ccagtgccat ggagttacag cgatgcatgt caatccttag ataaaaccac tagctcaggt
     4201 taccctcacc ataagaagaa gaatgatgac tggaatggca ctgccttcat cagggaattg
     4261 ggggagcaag cggcgcacgc caataacatg tatgaacaag gtaagagtat gaagcccatg
     4321 tacacggcgg cgcttaagga tgaattggtg aagccagaaa aagtgtacca aaaagtgaag
     4381 aagcgcttgc tttggggggc agatctagga acagtgatcc gggctgcacg agccttcggc
     4441 ccattctgtg acgccataaa atcccacaca ataaaactac ctatcaaagt tgggatgaat
     4501 tcaattgagg atgggccact aatttatgca gagcattcaa aatataaata tcactttgat
     4561 gcagactata cagcttggga ctcaacacaa aataggcaaa ttatgactga atcattctca
     4621 attatgtgcc gattgaccgc ttctccagaa ttggcctcag tggtagcaca agatctactc
     4681 gcaccctcag aaatggacgt tggtgactac gtcataagag taaaggaagg ccttccatct
     4741 ggctttccat gcacatcaca ggtcaatagc ataaaccatt ggttgataac tttgtgtgcc
     4801 ctctctgagg tgactggcct gtcaccagat gttattcagt ctatgtcata cttctctttc
     4861 tatggtgatg atgaaattgt ttccactgac atagaatttg atccagctaa attgacacaa
     4921 gtccttaaag agtatggcct taagcccacc cgccccgaca agagtgaagg tccaataatt
     4981 gtgaggaaga gtgtggatgg cttagtcttc ttacgccgca ccatttctcg cgatgccgcg
     5041 gggttccaag ggcgactaga ccgagcgtcc attgaaaggc aaatctattg gaccagagga
     5101 cccaatcact cagacccttt tgaaactttg gtgccccacc aacaaagaaa aatccagtta
     5161 atatcactgt taggtgaggc ttcattgcat ggtgaaaagt tctacaggaa gatctcaagc
     5221 aaagtcatcc aagaagttaa aacagggggc cttgaaatgt atgtgccagg gtggcaagcc
     5281 atgttccgtt ggatgcggtt tcatgatctt ggcttgtgga caggagatcg caatctcctg
     5341 cccgaattcg taaatgatga tggcgtctaa ggacgcccca acatcccctg atggcgccag
     5401 tggcgccggc cagctggtac cggaggctaa cacagctgag caaatttcaa tggaccctgt
     5461 cgcgggtgct tcaacagcag tcgcgacggc tggacaagta aatatgattg acccttggat
     5521 tttcaataac tttgtccagg cgccccaagg agaattcact atttccccta acaatacccc
     5581 cggtgatatt ttgtttgatt tacaattagg accccacctt aacccatttc tagcccatct
     5641 ctcacagatg tataatggtt gggtcggcaa tatgcgtgtg cgcatactgt tggccgggaa
     5701 tgcctttaca gctggaaaga taatcatttg ttgtgtcccc cctggttttg atgctagaat
     5761 actcacaata gctcaagcaa ccctcttccc acacttaatt gctgatgtga ggacccttga
     5821 gcctgtggag cttcctttgg aggatgtgcg caacgttctc taccacaata gtagccagcc
     5881 gcaaccaaca atgcggctgg ttgctatgtt gtataccccc ctccgcactg gtggtggttc
     5941 cggaggcact gatgcctttg tggtggcggg tagggtgctc acgtgccctg cccccgattt
     6001 cagtttcttg tttcttgttc ccccttctgt tgaacaaaag actagagttt tcagtgtccc
     6061 caacataccc ctaaaagatc tctcaaattc tcgtgtccct gtgcccgtac agggcatgtt
     6121 tatgtctcca gatgttaatc agtcagtcca gttccagaat gggcgttgcc aaattgatgg
     6181 tcaactccag ggcaccaccc cagtctcact cagccaactc tgcaagatta ggggtaaaac
     6241 ttctagcaat gctagggtgc tcaacttaag tgaagtggat ggtacacctt ttatccccct
     6301 tgaatcacca gcaccagttg gcttccccga cttgggaggc tgtgactggc atgtaaattt
     6361 cactttccag gcccaaaatc aggacccatc ccaaagtgtg acctttgcaa ctaatgatgc
     6421 cagctttgtc ccttacctag gtagcatctc ccctcataac gggggggact ttcatacagg
     6481 tgacatcata ggcagccttg gatggatttc agcgccgtct gacaactcac aacttaatgt
     6541 ttggacaata ccaaagtatg gatctagtct cccagatgtc acccatcttg ctcctgctgt
     6601 attcccccca ggctttgggg aggtgatcct atatttctat tccaccttcc caggctctgg
     6661 gcaacctagt caactccaag tcccatgttt gttaccccag gagttcatca cccacttctg
     6721 taatgaacaa gctcccatcg ctggggaggc tgccctcctc cactacgtgg accctgatac
     6781 gggccggaac ttgggagagt tcaaacttta ccctgatgga tttatgacct gtgtccccaa
     6841 tagtgttagc agtggccctc aaaccctacc tatcaatgga gtctttgtct ttgtttcatg
     6901 ggtgtctaga ttctatcaac ttaagcctgt gggaacggcc tcagcggcta gaaggcttgg
     6961 actgcggcgc atataatggc tcaagctgtc atcggtgcca tagccgcgtc tgccgctggt
     7021 agcatactag gggcaggcat acaggctggt gctgaggctg gtctccaggc tcaacggtac
     7081 cagcaggatc tacaattgca gcaaaattct ttcaagcatg ataaggaaat gttaggctat
     7141 caagttcagg ctagtaatgc tcttttagct aagaatctta acactagata tgcccttctg
     7201 caggcagggg gcctgtctag tgctgatgct gcccgggcag tggctggtgc tcctgtcacc
     7261 cgtatagtgg attggaatgg cacgcgcatt gcagctcctg cctcaagtgc cactacactt
     7321 agatctggtg gtttcatggc cgtccctata ccattgtcct caaagaccaa gcaaccagtg
     7381 atgtctgggc aggataatcc aaattatgct gcttcttcta tctctagaac tgcttcatgg
     7441 gtgcaatctc aaaattctat gaggtctgtt tctccctttc acagtgatgc tctgaggacc
     7501 gtttgggtta cgccacccgg ttcatcatca acctcatctg tgcagtctag tttttatggt
     7561 gtttttaata cagatagatt acctctgttc gcaaacagaa ggtaaaattt tgtaatagga
     7621 tgccagtggg cac
//