Typing tool

Complete norovirus genomes

MN199033  GII.3
 GII.P12

Length: 7,565 | 3 CDS

ORF1: 2..5101
ORF2: 5082..6728
ORF3: 6728..7492
LOCUS       MN199033                7565 bp    RNA     linear   VRL 27-JUL-2019
DEFINITION  Norovirus GII isolate CAU140599 nonstructural polyprotein (ORF1),
            VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MN199033
VERSION     MN199033.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7565)
  AUTHORS   Seo,D.J., Jung,D., Jung,S., Ha,S.K., Ha,S.D., Choi,I.S., Myoung,J.
            and Choi,C.
  TITLE     Experimental miniature piglet model for the infection of human
            norovirus GII
  JOURNAL   J. Med. Virol. 90 (4), 655-662 (2018)
   PUBMED   29106738
REFERENCE   2  (bases 1 to 7565)
  AUTHORS   Choi,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2019) Infectious disease, College of veterinary
            medicine, Konkuk University, 120, Neungdong-ro, Gwangjin-gu, Seoul
            05029, South Korea
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Trinity v. trinityrnaseq_r20140717, bowtie
                                     1.1.2
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7565
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="CAU140599"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="South Korea"
                     /collection_date="01-May-2014"
                     /note="genotype: GII.p12_GII.3"
     gene            2..5101
                     /gene="ORF1"
     CDS             2..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QDP15995.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELVPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     SELKQALKNVAIKSCQIVYGGCTYRLESDGKGDVRVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPQDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGRPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     2..991
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     992..2089
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2090..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6728
                     /gene="ORF2"
     CDS             5082..6728
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QDP15997.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPEFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRTSDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDHEADFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRVQ"
     gene            6728..7492
                     /gene="ORF3"
     CDS             6728..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QDP15996.1"
                     /translation="MAGAFVAGLAGDIFTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPSATSTTSMSGGFTNQVVHRTTPNFKMNQAPKSTPSSGSSVRSLSTQVTSLSS
                     HSSGSSRSSGPTAASSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgcttccgc tgccgctgct gctaatagca acaacgacaa
       61 cgcaaaatct tcaagtgacg gagtgctttc tagcatggct gtcactttta aacgagccct
      121 cggggcgcgg cataaacagc ctcccccgag ggaaacacca caaaggcctc cacggccacc
      181 caccccagaa ctggtcaaaa agatccctcc tcccccaccc aacggggagg atgagctagt
      241 ggtctcttac agcgccaaag atggcgtttc tggtttgcct gaacttacca ctgtctggca
      301 accggatgag accaacacgg cattcagtgt tccccctctc aaccagaggg agaacaggga
      361 cgccaaggag ccgctgaccg gaacaatcct ggaaatgtgg gacggggaga tctatcatta
      421 cggtctgtat gtggagcgag gccttgtact tggtgtgcac aaaccaccag ctgccatcag
      481 cctcgccaag gttgaactag taccactctc tctgttttgg aggccagtgt acacaccaca
      541 gtatctcatc tctccagaca ctctaaggag actgcatgga gagtcgttcc cctacacagc
      601 ctttgacaac aactgctatg ccttctgttg ttgggttctg gacctaaacg actcgtggtt
      661 gtgcaggaga atgatccaga gaacaactgg cttcttcaga ccttaccaag aatggaacag
      721 gaaacccctc cccaccatgg atgactctaa attgaaaaag gtagccaaca tattcttgtg
      781 tgcgctatct tcgctattca ctaggcccat caaagacata ataggaaagg tgagaccgct
      841 caacatcctt aacatcctgg cctcatgtga ttggactttt gcaggcatag tggaatcttt
      901 gatcctcttg gcagagctct ttggagtttt ctggacaccc ccagatgtgt ctgcgatgat
      961 cgccccctta ctaggtgact acgaactaca ggggcctgag gaccttgcag tggaactcgt
     1021 accagtagtg atggggggga ttggtttggt gttaggattc accaaagaga agatcggaaa
     1081 aatgttgtca tctgctgcat ccaccttaag agcttgtaaa gaccttggtg catacggact
     1141 ggaaatccta aaattggtca tgaaatggtt cttcccaaag aaagaggaag caaatgagct
     1201 agctatggtg aggtccatcg aggatgcggt gctggacctc gaagcaattg agaacaacca
     1261 catgaccgcc ctcctcaaag acaaagacag cttggcaacc tacatgagga cccttgacct
     1321 cgaggaggag aaagccagga agctttcaac caagtctgct tcacctgaca tcgtgggcac
     1381 aatcaacgct ctcctggcga gaatcgccgc tgcacgttcc ctggtgcatc gggcgaaaga
     1441 ggaactctcc agcagaccaa gacctgttgt tgttatgata tcaggcagac cagggatagg
     1501 gaaaactcac cttgccaggg agctagccaa gaagatcgca gcttcgctca caggggacca
     1561 gcgcgtgggc ctcatccctc gcaatggcgt tgaccactgg gatgcataca agggagaaag
     1621 agtcgtccta tgggacgatt atggaatgag taatcccatc cacgacgccc tcaggttaca
     1681 ggaacttgct gacacctgcc cccttacgct aaactgtgac aggattgaga acaaaggaaa
     1741 ggtctttgac agtgatgcca taatcatcac cactaatcta gccaacccag caccattgga
     1801 ctatgtcaac tttgaagcat gctcgaggcg cattgatttc ctcgtgtacg cagaagctcc
     1861 tgaggtcgag aaagcaaagc gtgatttccc aggtcaacct gacatgtgga agaacgcatt
     1921 tagctctgac ttctcgcaca taaaactggc gctggctccg caaggtggtt tcgacaagaa
     1981 cggaaacacc ccacacggga aaggcgttat gaaaaccctc accactggtt ccctcatcgc
     2041 ccgagcatca gggctactcc atgagaggtt agatgagtac gagctgcagg gcccaacccc
     2101 caccaccttt aactttgacc gcaacaaggt gcttgcgttc agacagcttg ctgccgaaaa
     2161 caagtacgga ttgttggaca caatgagagt tggaaaacag ctcaaggatg ttaagaccat
     2221 gtcagagctc aaacaggcac tcaagaatgt cgcaatcaag agttgtcaga tagtgtatgg
     2281 tggctgcacc tacaggcttg agtctgatgg caagggtgat gtaagagttg acagagttca
     2341 gaacgccact gtacagacca acaatgagct tgccggcgcc ctacaccatc ttaggtgcgc
     2401 cagaatcaga tattatgtca agtgtgttca ggaggccctg tattccatca tccaaattgc
     2461 tggggctgca tttgttacca cgcgcattgt caagcgcatg aacatacaag atctctggtc
     2521 caagccacag gtggaggata cagaggaaac cgctagcaag gatgggtgcc caaaacccca
     2581 ggatgatgaa gagtttgttg tctcatccga tgacatcaaa accgaaggca agaaagggaa
     2641 gaacaagtct ggccgtggca agaagcacac agcattctca agtaaaggtc tcagtgatga
     2701 agagtacgat gagtacaaaa gaatcagaga agaaagaaat ggcaaatact ccatagagga
     2761 atacctccag gacagagaca ggtactatga ggaggtggcc atcgccaggg caaccgaaga
     2821 ggacttctgt gaagaagaag aggccaagat ccgacagagg atctttaggc caacaagaaa
     2881 acaacgcaaa gaggagagag cctctctcgg tttggtcaca ggttctgaaa tcaggaagag
     2941 gaacccagac gacttcaagc ctaaaggaaa actgtgggct gatgatgaca ggagtgttga
     3001 ctacaatgag agactcaatt ttgaagcccc accaagcatc tggtcgagga tagtcaactt
     3061 tggctcaggt tggggctttt gggtttcccc cagcctgttc ataacatcaa ctcatgtcat
     3121 accccagggc gcacaggagt tctttggtgt acccatcaaa caaattcaga tacacaaatc
     3181 aggtgaattc tgccgcttga ggtttccaaa gccgatcaga actgacgtga caggcatgat
     3241 cttagaagaa ggtgcacccg aagggaccgt ggtcacatta ctcattaaaa gaccaactgg
     3301 agagctcatg cccctggcag ccagaatggg aacccacgca accatgaaga tacaagggcg
     3361 cactgttgga ggtcaaatgg gcatgctcct aacaggatcc aacgctaaga gtatggacct
     3421 gggcaccaca ccaggtgact gtggctgccc ctacatttac aagaggggga atgactacgt
     3481 ggtcattggg gtccacacag ctgccgcccg tggaggaaac actgtcattt gtgccaccca
     3541 ggggagcgag ggagaagcca cacttgaagg cggtgacagc aaggggacct actgcggtgc
     3601 accaatctta ggtccaggaa gtgccccaaa actcagcacc aagaccaagt tctggaggtc
     3661 atccacggca ccactcccac ctggtaccta tgagccagct tacctcggcg gcaaggaccc
     3721 cagagttaag ggtggccctt cactgcaaca agttatgagg gatcaactga aaccattcac
     3781 tgagcctagg ggtagaccac caaaaccaag tgtgctagaa gctgccaaga aaaccatcgt
     3841 caatgtcctt gaacagacaa ttgacccacc tcaaaagtgg tcgtttgcgc aggcatgcgc
     3901 atcccttgac aagaccactt ctagcggtca tccgcaccac atgcggaaga acgactgttg
     3961 gaacggggag tcctttacag gaaaattggc agaccaggct tccaaggcca acctgatgtt
     4021 tgaggaggga aagaacatga ccccagttta cacgggtgcg cttaaggacg agctggtcaa
     4081 gactgacaag atttatggta agatcaaaaa gaggcttctc tggggttcgg acctggcgac
     4141 catgattcgg tgcgctcgag cattcggggg tctgatggag gaactcaaag cacattgtgt
     4201 cacactacct gttagggtgg gtatgaatat gaatgaggat ggccctatca tctttgagag
     4261 acactccagg tataaatatc attatgatgc tgactactcc cggtgggatt caacacaaca
     4321 aagagccgtg ttggcagcag ccttagaaat catggtcaag ttttccccag agccgcacct
     4381 ggcccaaaag gttgcagaag accttctttc tcccagtgtg atggacgtgg gtgatttcaa
     4441 aatatcaatc aatgagggtc tcccctccgg agtgccctgc acctcccaat ggaattccat
     4501 cgcccactgg ctcctcactc tctgtgcact ctccgaggtt acaaacctgt cccctgacat
     4561 tattcaggcc aactctctct tttctttcta cggtgatgat gaaattgtga gtacagacat
     4621 aaaattggac ccagaaaaac tgacagcaaa acttaaggaa tacgggttga aaccgacccg
     4681 ccctgacaag actgaagggc ctcttgtcat ttccgaagac ctgaatggcc taaccttcct
     4741 gcggaggacc gtgactcgcg acccagcagg ctggtttgga aagttggaac agagctcaat
     4801 actcagacaa atgtactgga ctaggggccc caaccatgaa gatccatctg aaacaatgat
     4861 accacactcc cagaggccca tacaattgat gtctttgctg ggtgaggcag cactccacgg
     4921 cccagcattc tacagcaaaa tcagtaaact ggtcattgca gagttgaagg aaggtggcat
     4981 ggatttttac gtgccaagac aagagccaat gttcagatgg atgagattct cggatctgag
     5041 cacgtgggag ggcgatcgca atctggctcc cagttttgtg aatgaagatg gcgtcgaatg
     5101 acgccacccc atctaatgat ggtgccgccg gcctcgtccc agagatcaac aatgaggcaa
     5161 tggcgctaga gccagtggcg ggtgcagcga tagcggcacc cctcactggc cagcaaaata
     5221 taattgatcc ctggattatg aataattttg tgcaagcacc tggtggtgag ttcacagtgt
     5281 ctcctaggaa ttcccctggt gaagtgctcc tcaatttgga attgggccca gaaataaacc
     5341 cctatctggc ccatcttgct agaatgtata atggttatgc aggtgggttt gaagtgcagg
     5401 tagtcctagc tggaaatgcg tttacagcag gaaagataat ctttgcagct atacccccta
     5461 acttcccaat tgacaatcta agtgcagcac agatcacaat gtgcccacat gtgattgtgg
     5521 atgtcaggca gttggaaccg gtcaacctcc cgatgcctga cgttcgcaat aacttcttcc
     5581 actacaacca agggtctgat tcgagattgc gcttggttgc aatgctgtac acacctctta
     5641 gggcaaataa ctctggggat gatgttttca ctgtgtcttg tagagtgctg actagaccta
     5701 gccctgaatt ttcatttaac ttccttgtgc cacccactgt ggagtcaaag acaaaaccct
     5761 tcaccctccc aattctgact atctctgaaa tgtctaattc taggtttcca gtgccgattg
     5821 attctctgca caccagccca actgagaata ttgttgtcca gtgccaaaat gggcgcgtca
     5881 ctcttgatgg tgagttgatg ggcaccactc agctcttacc tagtcaaatc tgtgctttca
     5941 ggggcgtgct cactagatca acaagcagga ctagtgacca ggccgacaca gcaaccccta
     6001 gattgtttaa ttattattgg cacatacaat tggataatct aaatgggact ccttatgatc
     6061 ctgcagaaga cataccaggc cccctgggga caccagattt ccggggcaaa gtctttggcg
     6121 tggccagcca aagaaacccc gacagtacaa ctagagcaca tgaagcaaag gtggacacaa
     6181 cagctggtcg cttcacccca aaactaggct cactagagat atccactgaa tctggtgact
     6241 ttgaccaaaa ccaaccaaca agattcaccc cagttggcat tggggttgac cacgaggcag
     6301 acttccaaca atggtcctta cccgactact ctggccagtt cactcacaac atgaacttag
     6361 ccccagctgt tgctcccaac ttccctggtg agcagctcct tttcttccgc tcacagttac
     6421 catcttctgg tgggcgatcc aatgggattc tagactgcct ggtcccccaa gaatgggttc
     6481 agcacttcta ccaagaatca gcccccgccc aaacccaggt ggctctggtt agatatgtca
     6541 accctgacac tggtagagtg ttgtttgagg ccaagctgca caaattaggc ttcatgacta
     6601 tagctaagaa tggtgactct ccaataactg ttcccccaaa tggatacttt aggtttgaat
     6661 cttgggtgaa cccattttat acacttgccc ccatgggaac tgggaatggg cgtagaagag
     6721 ttcaataatg gctggagctt ttgtagcagg attagctggt gatatattca caaacactgt
     6781 agggtctcta gttaatgcag gggctaatgc tattaatcaa aaagttgatt ttgaaaataa
     6841 taaatatttg caaaatgctt ccttcaatca tgataaggaa atgttaaatg cacagattga
     6901 ggcaacaaag aggttacagg ctgacatgat tgctatcaaa cagggggttt tgaccgctgg
     6961 cggcttttcc cccactgatg cagctcgcgg ggcaattaat gcccccatga caaaagtcct
     7021 agattggaat ggaacaaggt actgggcacc aagtgccacc tctacaacct cgatgtcggg
     7081 tggcttcaca aaccaggttg tgcacagaac cacgccaaat tttaaaatga accaggcccc
     7141 caaatccaca cccagcagtg ggtcttcagt gaggtcactc tcaacccaag tcactagtct
     7201 gagctcacac tcgtccgggt cgtctcgatc cagcgggcct acagctgcta gctcgttacc
     7261 atcctctaac aggactaggg actgggtcaa tcagcagaat ttcaatttgg aaccacacat
     7321 gcctgggtca cttaggacgg cttttgtcac tccaccatct agtacagcct ctagttcagg
     7381 cactgtctca accgtgccca aaaatgtttt ggactcctgg acatctgcgt ttaacacgcg
     7441 cagacagccg ctattcgcac accttcgtag aaggggggag tcaaatgttt agtgaaaagg
     7501 ttatcttaaa tttgatttaa attggatttg atttggaacc ttttaaaaaa aaaaaaaaaa
     7561 aaaaa
//