Typing tool

Complete norovirus genomes

MK775029  GII.2
 GII.P2

Length: 7,503 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6712
ORF3: 6712..7491
LOCUS       MK775029                7503 bp    RNA     linear   VRL 15-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Richland0514
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK775029
VERSION     MK775029.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7503)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7503)
  AUTHORS   Barclay,L., Cannon,J.L., Brandt,E., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7503
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Richland0514"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Richland0514"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="27-Jan-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBY35936.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGVLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTAGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFASIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNITIRKCQIVYGGNTYTLESDGKGRVVVERVQNASVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLTEDADEATMKEGC
                     PKPRDEEEFVVSSEDIRPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     4..993
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     994..2091
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2092..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6712
                     /gene="ORF2"
     CDS             5084..6712
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBY35937.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKQNSPGHDEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGSPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6712..7491
                     /gene="ORF3"
     CDS             6712..7491
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBY35938.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGKFTSTAPVRQADFQHTQNRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttct gctgccgctg ctgttaacag caacaacgac
       61 aacacaaaat cttcaagtga cggagtgctt aacaacatgg ccgtcaccct taaacgagcc
      121 cttggggccc ggcccaaaca gccggccccg agagaaaaac ccccaagacc ccctagacca
      181 ccaacaccag aactaattaa aagaatcccc cccccaccac ctaatgatgg ggatgaacca
      241 accgtgatgt ttagcactgc aggtggtgtg tctggcctac ctgagctcac aacagtcggt
      301 caaccacctg aagctaacac ggcctttagc gtgccccccc tcagccaaag ggaaaacagg
      361 gacgctaagg agccgctaac tggagctatt ctggaaatgt gggacgggga gatttatcac
      421 tatggactgt atgtggaaaa agggcttgtg ttaggcgtgc acaagccacc ggctgccatt
      481 agcatagcca aagtggaatt aacgcctctc tcactgtact ggaggcctgt gtacacgcct
      541 cagtacctca tatctccaga caccttgagg aaactccacg gtgaactatt tccctataca
      601 gcctttgaaa acaactgtta tgccttctgc tgttgggttt tggaccttaa cgattcatgg
      661 ctaagcagga ggatgattag taggactact ggctttttca ggccctacca agagtggaac
      721 aggaagcccc tcccaaccat ggatgactca aaattgaaaa aggtcgcaaa catcgttcta
      781 tgtgcattgt catcattgtt cactagaccc attaaggata taattggcaa gcttaaaccc
      841 ctcaacatcc tgaacatttt ggcctcgtgc gactggacct tcgctagcat agttgagtca
      901 ctaatcctct tggctgaact ctttgatgtg ttctggacac ccccagatgt gtctgcaatg
      961 atcgcacccc tcctcggtga ctatgagcta caaggccctg aagacatcgc tgtggagctc
     1021 gtacccgttg tgatgggtgg gataggtctg gtgctgggat tcaccaaaga gaaaataggt
     1081 aagatgctct cctctgcagc atcaactttg agggcatgca aagatcttgg agcctatgga
     1141 ctggagatac tgaaactagt catgaaatgg ttcttcccaa agaaggatga ggccaacgaa
     1201 ctggctatgg ttagagccat tgaagacgct gtattggacc tggaggccat tgagaacaac
     1261 catatgacca ctctattgaa agacaagaac agccttgcag cctacatgaa gaccctggac
     1321 atggaagagg aaaaagctag gaagttatcc accaaatcag cctcccctga cattgtgggc
     1381 actataaatg ccctgttggc taggatcgct gccgcgcgtt ccttagttca tagggccaag
     1441 gaggagctct ccagcaggcc aaggccggtc gttttgatga tctctggcaa gccagggata
     1501 ggaaagaccc acttggccag agaactggca aagaaaatcg cctcaacact cacaggagac
     1561 cagagagtgg gcctcatccc acggaatgga gttgaccatt gggatgccta caaaggtgag
     1621 agagtggtgc tctgggatga ttacgggatg agcaacccca tccacgatgc gctgaggttg
     1681 caagaactgg cagacacatg tccattgact ctaaattgtg acaggattga aaataagggg
     1741 aaagtcttcg acagcgatgc gatcataatt accaccaatt tggtcaatcc cgcgccgctg
     1801 gattatgtca actttgaggc ctgctccaga cgcatagact tccttgtgta tgctgatgcc
     1861 ccagaagtcg agaaagcaaa gcgggacttc cccggccaac cagacatgtg gaaggacgcc
     1921 tatcgccctg acttctcaca catcaaacta caacttgcac cacaaggtgg gtttgacaaa
     1981 aatggtaaca cccctcatgg taaaggagtg atgaagactc tcactgccag ctcactggtt
     2041 gcgcgtgcct ctggtctctt gcacgagagg ctagatgagt acgaattgca aggtccaccc
     2101 ctctcaacct tcaactttga ccgcaacaaa attgcagcgt tcagacaact cgctgctgaa
     2161 aacaagtatg gactggtaga cacgatgagg gtgggtaacc agctcagaaa tgttacgacc
     2221 atggatgaac tcaagaaggc tatcaagaac atcacaatca gaaagtgcca gatagtctat
     2281 ggtggcaaca cttacacgct tgagtctgac ggcaagggta gagttgtggt tgagagggtg
     2341 cagaacgcca gcgtgcaaat caacaatgag atcgccggtg cagtacatca ccttagatgt
     2401 gccagaatac ggtattatgt taagtgtgtc caagaggcca tctactcact cctccaaatt
     2461 gctggcacgg tgtttgtcac ttcacgcatc gtaagccgca tgaacatcca aaatttatgg
     2521 tccaggccat taactgaaga tgcagatgag gccaccatga aagaggggtg ccctaaacct
     2581 agggatgaag aagaatttgt cgtctcctca gaagatatca ggccagaggg caagaaaggt
     2641 aaaaacaaga gtggccgggg caagaaacac acggcgttct caagcaaagg tctcagtgat
     2701 gaggagtacg aagagtacaa aaggattaga gaggagagaa atggcaaata ctccatagag
     2761 gaatacctac aggacagaga caagtactat gaagaggtgg ccattgccag ggcaactgaa
     2821 gaagacttct gtgaagaaga agaggttaag attcgtcaga ggatcttcag gccaactaga
     2881 aagcaacgca aggaagaaag agccaacctt ggcctcgtca ccggatctga gatcagaaag
     2941 aggaacccag atgactttaa accaaaagga aagctgtggg ccgacgatga taggagcgtc
     3001 gactacaacg aaagaatcag ctttgaggcc ccaccaagca tttggtctag aattgtcaac
     3061 tttggttctg ggtgggggtt ttgggtgtca cctagcctct tcataacatc aacacatgtc
     3121 ataccccaag gcataactga agcctttggt gtacccataa ggcaagtgca aatacacaaa
     3181 tcgggcgaat tctgtcgcct gagattccca aaacccatca ggacagatgt gtcaggtatg
     3241 atactggagg agggagcgcc tgaaggcact gttgccacca tactcatcaa gagaaccact
     3301 ggagaactga tgccccttgc agcaagaatg ggcacccacg cgactatgag gatacaaggg
     3361 cgcacggtgg gcggccaaat gggaatgctg ctcactggat ccaatgcgaa gagcatggat
     3421 cttggcacca cgcctggtga ctgtgggtgc ccttatattt acaaaagggg caatgattac
     3481 atagtcattg gagttcacac agcagctgcc cgtggcggaa acactgtcat ctgcgccaca
     3541 caaggtagtg agggtgaggc cacactcgag ggtggtgaca acaaagggac atactgtggg
     3601 gcaccaatcc taggacccgg gagtgccccg aaactgagca ctaagaccaa attctggagg
     3661 tcctctacaa caccactccc acctggcaca tacgagccgg catatctggg aggaaaagac
     3721 ccccgagtca aaggtggacc atctctgcaa caagtcatgc gagaccaact gaagccattc
     3781 accgaacccc gtggtaagcc accaaaacca agtgtccttg aagctgccaa aaagacaatt
     3841 atcaatgtgc tagagcaaac aatagacccc ccacaaaagt ggacgtacgc gcaagcgtgc
     3901 gcgtctcttg acaaaaccac atctagcggg tttccccacc acgtgcgcaa aaacgagcac
     3961 tggaatgggg aatctttcac aggaaaattg gctgatcagg catcaaaagc aaacctaatg
     4021 tttgaagagg gaaaacacat gaccccagtt tacacagctg cccttaagga tgagttggtc
     4081 aaaactgaga aggtgtatgg gaagataaag aagaggttgc tttggggctc tgatctggcc
     4141 acaatggtgc ggtgcgcgcg ctcttttggt ggtttgatgg acgaacttaa ggcccactgt
     4201 gtaacacttc cgataagggt tggcatgaat atgaatgaag atggaccaat agtctttgag
     4261 aaacattcca gatacaggta tcactatgat gcagactatt ccaggtggga ttcaacacag
     4321 cagagagccg ttctggctgc ggccatggag atcatggtta aattctcagc agagccacaa
     4381 ctagcccaaa tagttgcaga ggacctactg tcgcctagtg tagttgatgt gggcgacttc
     4441 aaaatttcca tcaacgaagg gttaccatca ggtgtccctt gcacctctca atggaactcc
     4501 attgcacact ggctcctcac cttgtgtgcc ctttctgaag ttacagatct ctctcccgat
     4561 attgtgcaag ccaactccct cttctccttc tatggtgatg atgaaattgt gagtacagac
     4621 attaaattag acccagaaaa gttgacgggg aagttgagag aatacggtct caaacccact
     4681 cggcctgaca agactgaggg ccccctgatc attagcgagg atctgaatgg cctgaccttc
     4741 ttgaggagaa ccgtcacccg cgaccctgca ggatggtttg gcaaactgga ccagagctct
     4801 atactcaggc aattgtattg gaccaagggt cctaatcatg aagacccctt tgagtcaatg
     4861 attccacact cccagaggcc catacaactc atgtcactct tgggcgaagc agcactgcat
     4921 gaaccatcgt tttacagcaa gatcagcaag cttgtgatat ctgagttgaa agaaggtgga
     4981 atggattttt acgtgcccag gcaagaaccc atgttcaggt ggatgagatt ctcggatttg
     5041 agcacgtggg agggcgatcg caatcttgct cccagtcttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctactg atggtgcagc cggcctcgtg ccagaaagta acaatgaggt
     5161 catggctctt gaacccgtgg ctggtgccgc cttggcagcc ccagtcaccg gtcaaacaaa
     5221 tattatagac ccttggatta gagcaaattt tgtccaggcc cccaacggtg aattcacagt
     5281 ttctccccgt aatgcccctg gtgaagtgtt attgaatcta gagttgggtc cagaattaaa
     5341 tccttatctg gcacatttag caagaatgta taacgggtat gccggtggga tggaggtgca
     5401 ggtcatgttg gctgggaacg cgttcacagc cggcaagttg gtcttcgccg ctgtaccacc
     5461 tcacttcccg gttgaaaacc ttagcccaca gcaaattacc atgttccctc atgtgattat
     5521 agatgtaagg accttagaac ctgttttatt accacttcct gatgttagga acaatttctt
     5581 ccattataat cagaaagatg atcctaaaat gagaattgtg gctatgcttt acacccccct
     5641 taggtctaat ggttcaggtg atgatgtgtt cacagtctct tgcagggtgt tgactagacc
     5701 ctcccctgat tttgatttca catatctggt gccaccaaca gtggaatcta aaacaaaacc
     5761 attcactctc ccaatcctca cacttgggga actttccaat tctaggttcc cagtgtccat
     5821 agaccagatg tacaccagcc ccaatgaggt catatcagtg cagtgtcaaa atggtaggtg
     5881 cacattggac ggggagcttc aggggacaac acaactccaa gtcagtggta tttgtgcttt
     5941 caagggggaa gtgaccgccc atttgcatga caatgaccac ctatataatg tcaccatcac
     6001 aaacctgaat gggtccccct ttgacccctc cgaggacatt cctgcccctc tgggcgtgcc
     6061 tgatttccag ggaagggtct ttggtatcat ctcccaaaga gataaacaga atagccctgg
     6121 gcacgatgaa ccagcaaaca ggggacacga cgctgtggtc cctacttaca cagcacagta
     6181 caccccaaaa ttgggtcaga ttcaaattgg cacatggcag accgacgatc tcacagtcaa
     6241 ccaaccagtc aaatttaccc cagttggtct caatgacact gaacatttta accaatgggt
     6301 ggtccccaga tacgcaggtg ccctaaacct caacacaaac cttgcccctt ctgttgctcc
     6361 agtgtttcca ggagagcgcc tgcttttctt cagatcatat attcctctca agggtggtta
     6421 tggaagtcca gccattgatt gcctactacc acaagagtgg gtgcaacact tctatcagga
     6481 ggctgcccca tcaatgagtg aggtggccct tgtcagatac attaacccgg acactggtcg
     6541 ggcactgttt gaggccaagc tccacagagc tggtttcatg acagtctcga gcaacaccag
     6601 tgccccggtg gttgtgcctg ccaatggata cttcagattt gactcttggg tgaatcaatt
     6661 ctattctctc gcccccatgg gaactggaaa tgggcgtaga agggttcaat aatggctgga
     6721 gcttttgtag ctggtcttgc aggggacgtg ctcagcaatg ggctcagttc attaattaat
     6781 gcaggtgcta atgcaataaa tcagagggca gagtttgatt ttaatcagaa attacagcaa
     6841 aattctttta atcatgataa ggagatgttg caggctcaga ttcaggcaac taagcagctg
     6901 caggcagaca tgatggctat taaacagggg gttctgaccg ctggcggctt ttcccctgct
     6961 gatgcagcca gaggtgccgt gaatgcgccc atgacacagg cgctggactg gaacggcaca
     7021 aggtattggg caccaggctc tatgaggacc acatcttatt ctgggaaatt cacatcaacc
     7081 gccccagtga ggcaggccga ctttcagcac acccaaaacc ggccatcgag tggctcttct
     7141 gtgtcctcct ttgccactca atcttcaagg ccaactctga ccacaaccac tgggtcctca
     7201 catggcacag cctcatcaaa ttcaactcgc agcacgagcc tctcccaatc aacggtctct
     7261 agagctacat ctaggactag tgagtgggtt agagatcaaa atagaaattt ggaaccctac
     7321 atgcatggtg ccttacagac agcctttgtc accccaccct ccagcagggc gtctgatggg
     7381 acagtctcaa ccgtcccaaa gggtgttttg gactcctgga cacctgcgtt caacacccgc
     7441 aggcagccgc tctttgcaca cctccgtaag aggggggagt cacaagctta gtgaaaaggt
     7501 gga
//