Typing tool

Complete norovirus genomes

MK773587  GII.2
 GII.P16

Length: 7,527 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MK773587                7527 bp    RNA     linear   VRL 14-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.2/Hennepin0273
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK773587
VERSION     MK773587.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7527)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7527)
  AUTHORS   Barclay,L., Cannon,J.L., Cebelinski,E., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7527
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hennepin0273"
                     /isolate="Hu/US/2017/GII.P16-GII.2/Hennepin0273"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="22-Dec-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBY34798.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGVSGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNKITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSIQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGNPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGRIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLATALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRMVTRDPAGWFGKLDQSSILRQIYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBY34799.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHMIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDVPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBY34800.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRNTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaagaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca aaaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tggggtctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 ggccataagc atggcaagag tggagctgac gccgctgtca ttgtactggc gtgtggtgta
      541 caccccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcattccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtacaaag aacaacgggc ttctttagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taagccatta aacatattga atatcctggc aacgtgtgac tggacttttg ccggaatagt
      901 ggagtctctg atattacttg ccgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatt gctcccttac tcggggacta cgagttgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggggggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcaga gcttgtaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggatgctgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccaggag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcgt tagtccacag
     1441 ggccaaggaa gagctatcta gcaggataag accagtggtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcgaga aaggtggcat ccaccctcac
     1561 aggggatcaa agagtcggac tcataccacg aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc cctcacctta aattgtgaca gaattgaaaa
     1741 taagggaaaa gtttttgaca gtgaagtcat aataattaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccagaaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggactttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacccc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcccacaatc accaccttca atttcgaccg gaacaaaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggat tggtggacac catgaaagtt ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat taggaacgtg accatcaaga ggtgccggat
     2281 catctacggt ggttccacgt atgaccttga atctgatggc aagggtaaag tattggtgga
     2341 aaaggtcaag aacacctcta tacagaccaa caacgagttg gctggggccc tgcaccatct
     2401 caaacatgcc cgaatcaggt actacgtcaa atgtgtgcaa gaagcagtct attccatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gtcagaagat gacgagttca tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatggaaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gctattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaagaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acaggagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccctccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtgtc accaagcctt ttcataacat caactcatgt
     3121 aatccccgca ggcataacag aagcatttgg agtccccatc aaacaaattc aggtccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca acccctggtg actgtggctg tccttacatc tataagaggg gcaatgacta
     3481 tattgtcatt ggggtgcaca ctgcagcagc ccgaggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctaggtcctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcaaac acgcccctcc caccagggac atatgagcct gcctacctcg gtggtcgtga
     3721 tccgcgtgtt aagggtgggc cttccctgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc agaggcaaac ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 catcaatgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gaatccccat cacgtccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaact ggcagaccaa gcatcaaagg caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtacacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaggatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aagcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatataaat atcactatga tgcagactac tctcgttggg attcaacgca
     4321 acagagggca gtactagcaa cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaattaca ataaatgaag ggctcccttc tggtgtgcca tgcacttctc aatggaactc
     4501 cattgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tgtcccctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccctgaac agttaaccgc caagttgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aaaaccgagg gacccctgat tatcagcgaa gatctgaacg gtctcacttt
     4741 cctccgaagg atggtgactc gtgatccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatatact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tctcaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aacaatgagg
     5161 tcatggctct tgaacctgtg gctggtgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tctctccccg aaatgcccct ggtgaagtgc tattgaatct agagttgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaatgggta tgctggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gccgtgccac
     5461 ctcacttccc ggttgaaaac cttagcccac agcaaatcac catgttccct cacatgatta
     5521 tagatgtgag aaccttggaa cctgttttat taccactccc tgatgttagg aacaacttct
     5581 tccattataa tcagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 tcaggtctaa tggttcaggt gatgatgtgt ttacagtctc ctgtagagtg ttgactagac
     5701 cttcccctga ctttgacttc acatacctgg tgccaccaac agtggagtct aaaacaaagc
     5761 cattcaccct cccaatcctc acacttgggg aactttccaa ttctaggttc ccagtgtcca
     5821 tagaccagat gtacaccagc cctaatgaag ttatatcagt gcagtgtcaa aatggtaggt
     5881 gcacactgga cggggagctc caagggacaa cacaactcca agtcagtggc atttgtgctt
     5941 tcaaaggtga agtgactgcc cacttgcatg ataatgatca cctatataat gttaccatca
     6001 caaacttgaa tgggtcccct tttgacccct ccgaggatgt ccccgcccct ctgggtgtgc
     6061 ctgacttcca gggaagggtt tttggtatca tctcccaaag agacaaacac aatagtcctg
     6121 ggcataatga accagcaaac agaggacacg acgctgtggt tcctacttac acagcacagt
     6181 acactccaaa actgggacaa attcaaattg gcacatggca gactgacgac cttacagtca
     6241 accaaccagt caaattcacc ccagttggac tcaatgacac tgaacatttt aaccaatggg
     6301 ttgtccctag gtatgctggt gccctaaacc tcaatacaaa ccttgcccct tctgttgctc
     6361 cagtatttcc aggagagcgc ttgctcttct tcagatcata tattcccctc aagggcggtt
     6421 atggaaaccc agccattgat tgcctactac cacaagagtg ggtgcaacac ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc tcgtcagata catcaacccg gacactggtc
     6541 gggcactgtt tgaggccaag ctccacagag ctggtttcat gacagtctcg agcaacacca
     6601 gtgccccggt ggttgtgcct gccaatggat acttcagatt tgattcttgg gtgaaccaat
     6661 tctattctct cgcccccatg ggaactggga atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggcttagtt cattaatcaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga aattgcagca
     6841 aaattctttt aatcatgata aggagatgtt gcaggctcag attcaggcaa ccaagcagct
     6901 gcaggcagac atgatggcca taaaacaagg ggtcttgacc gctggcggct tttcccctgc
     6961 tgatgcagcc agaggtgctg tgaacgcgcc catgacacag gcgctggatt ggaatggcac
     7021 aaggtattgg gcaccaaact ccatgaggac cacgtcttat tctggaaaat tcacatcaac
     7081 cgccccagtg aggcaggctg acttccagca cacccaaagc cggccttcga gtggctcctc
     7141 tgtgtcttcc tttgccactc agtcttcaag gccaactctg accacaacca ctggttcctc
     7201 acatggcaca gcctcatcaa attcaactcg caacacaagc ctctcccaat caacggtctc
     7261 cagagctaca tctaggactg gtgagtgggt tagagatcaa aatagaaatt tggaacccta
     7321 catgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg catctgacgg
     7381 gacagtctca accgtcccga aaggtgtttt ggactcctgg acacctgcgt ttaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaattta tttaggatga attgatt
//