Typing tool

Complete norovirus genomes

MK773585  GII.4 Sydney
 GII.P16

Length: 7,552 | 3 CDS

ORF1: 2..5101
ORF2: 5082..6704
ORF3: 6704..7510
LOCUS       MK773585                7552 bp    RNA     linear   VRL 14-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P16-GII.4 Sydney/Olmsted0261
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK773585
VERSION     MK773585.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7552)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7552)
  AUTHORS   Barclay,L., Cannon,J.L., Cebelinski,E., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7552
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Olmsted0261"
                     /isolate="Hu/US/2016/GII.P16-GII.4 Sydney/Olmsted0261"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="20-Nov-2016"
                     /note="genotype: GII.P16-GII.4 Sydney"
     gene            2..5101
                     /gene="ORF1"
     CDS             2..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBY34792.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KRPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PGVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGEYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAIYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRLRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVVRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIVFEKHSRYKYHYDADYSRWD
                     STQQRAVLASALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     2..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6704
                     /gene="ORF2"
     CDS             5082..6704
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBY34793.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     gene            6704..7510
                     /gene="ORF3"
     CDS             6704..7510
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBY34794.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAVLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGPSNKSS
                     NSSTVTSVYSNQTISTRLGSTAGSGTSVSSPPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgctaccgt tgccgttgct tgcaacaaca acaacgacaa
       61 ggaaaaatct tcaggtgaag gcttattcac aaatatgtct tccaccttaa agaaagccct
      121 cggggctagg cccaaacggc ccgccccgag agacgaacca caaaagcccc caagaccacc
      181 aactcccgag ttggtcaaga ggataccccc tcctccacct aatggcgaag aagaagaaga
      241 accagtcatt aggtatgagg ttaagagtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccaaccg ggcgtggcca acacagcatt cagtgttcca ccactgagct tgagagaaaa
      361 cagggaggcc aaggaaccgc taacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 cataagcatg gcaagagtgg agctgacgcc gctgtcattg tactggcgtg tggtgtacac
      541 tccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cgttccctta
      601 caccgccttc gacaacaact gctatgcctt ttgctgctgg gtgttagacc tcaatgactc
      661 atggcttagc aggaggatgg tgcaaagaac aacgggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccca ccatggatga ctccaaaatt aagaaggtag caaatatatt
      781 cctatgttca ttgtccacgt tattcaccag acccataaaa gacctcatag gaaaaattaa
      841 accattaaac atattgaaca tcctggcaac gtgtgactgg acgtttgccg gaatagtgga
      901 atctctgata ttacttgctg aactcttcgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttactcg gggaatacga gttgcaaggg ccagaagacc tcgccgttga
     1021 actcgtacct gtggtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac actcagggct tgcaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aggaggccaa
     1201 tgagctagcc atggtgaggg ccatagagga tgccgtacta gatcttgagg caatagaaaa
     1261 taaccacatg acaaccctgt tgaaagacaa agacagctta gcaacataca tgaaaacact
     1321 ggacatggag gaggagaaag ccagaaggtt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacaatc aacgccctgc tggctcgaat agcagcggcc aggtcattag tccacagggc
     1441 caaggaagag ctgtctagca ggataagacc agtagttgtt atgatatctg gcaaaccagg
     1501 gataggcaaa actcatctgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcggactca taccaagaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagtaac cccattcatg atgctcttcg
     1681 catacaagaa ttggctgata cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aaccttgcca atccagcccc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gatttcctgg tgtacgctga
     1861 ggcaccagaa gtagaaaagg caaaacggga ctttcctggt cagccagata tgtggaagga
     1921 cgccttcaag ccggactttt cacacatcaa gctacagctt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atgggaaagg agtgatgaag accctcacca ccggttctct
     2041 gattgcccgt gcatcaggcc tactgcatga aaggatggat gaatttgaac tccaaggtcc
     2101 cacaatcacc accttcaatt tcgaccggaa cagaatcaca gcattcagac aattggctgc
     2161 agaaaacaag tatggattgg tggataccat gaaagttggc aatcaactaa agggagtgaa
     2221 aaccatggaa gaactcaaac aagcaatcag gaatgtgacc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtacg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 agtcaagaac acctctgtac agaccaacaa cgagttggcc ggggccctgc accatctcaa
     2401 acacgcccga atcaggtact atgtcaaatg tgtgcaagaa gcaatctact ccatcataca
     2461 aattgccggc gctgcgtttg tcaccacgcg cattgcacgc cgcatgaaca tacaagaact
     2521 ctggtcgaag ccacaattag atcaaaatga atcagagact aaggaagagg cccccaagtc
     2581 agaagacgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctcc agcaagggtt tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gatagagaca ggtactatga ggagctcgcc attgccaagg ccacagaaga
     2821 agacttctgt gaagaggagg agatcaaaat ccgtcagaga attttccgtc ccaccaggaa
     2881 acaaagaaag gaagagaggg ccacattagg gctagtaaca ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ccaaagggaa gctgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagctt
     3061 tggttctggc tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccccgcaggc ataacagaag cgtttggagt ccccatcaaa caaattcaga tccacaaatc
     3181 aggtgaattt tgccgactca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg aaggcaccgt ggcaactgtg ctcatcaaac gccccaccgg
     3301 agagctcatg cctcttgcag ccagaatggg aacacacgca accatgaaaa ttcaaggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggatca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgact gtggctgccc ttacatctat aaaaggggca atgactacat
     3481 agtcattggg gtgcacactg cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 acccattcta ggccctgggg gtgcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg ccccttccac cagggacata tgagcctgcc tacctcggtg gccgtgatcc
     3721 gcgtgttaag ggtgggccct ccttgcagca ggtagtgaga gaccagttga agccattcac
     3781 tgaacccagg ggcaaacctc caagaccaag tgtattggaa gcagccaaac aaaccattat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgtgc
     3901 ctcacttgac aaaaccacct ccagcgggca tccccatcac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaattggc agaccaagca tcaaaagcaa acctaatgtt
     4021 tgaggaaggg aaacacatga caccagtgta tacagcagca ctcaaggatg agctagtcaa
     4081 gactgagaaa atctatggaa agatcaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgctaggt catttggtgg gctcatggac gagatgaagg cacactgcat
     4201 atcactccca gtacgagttg gcatgaatat gaatgaagat ggcccaatag tatttgagaa
     4261 acattccaga tacaaatatc actatgatgc agactactct cgttgggatt caacacaaca
     4321 gagggcagta ctagcatcag ctttggaaat catggtcaga ttctctgcag aaccacaatt
     4381 ggcacaaata gtcgctgagg atctgctggc ccctagtgta gtagatgtag gagactttaa
     4441 aatcacaata aatgaagggc tcccatctgg tgtaccatgc acttctcaat ggaactccat
     4501 cgcacactgg ctgctaactc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 catacaagca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgacat
     4621 aaaattggac cctgaacagt taaccgccaa gttgaaggag tacggcctga aaccaacccg
     4681 cccagacaag accgagggac ccctgatcat cagtgaagat ttgaacggac tcactttcct
     4741 ccgaaggacg gtgactcgtg acccagctgg ctggtttgga aaactggacc aaagctcaat
     4801 tctgaggcag atgtactgga ctagaggacc aaatcatgaa gaccctaatg agacaatgat
     4861 accccattct caaagaccca tacagctcat ggcactgctt ggtgaagcct ctcttcacgg
     4921 accctctttc tacagtaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgagtg
     5101 acgccaaccc atctgatggg tccgcagcca acctcgtacc agaggtcaac aatgaggtta
     5161 tggctttgga gcccgttgtt ggtgccgcta ttgcggcacc tgtagcgggc caacaaaatg
     5221 taattgaccc ctggattaga aataattttg tacaagcccc tggaggggag tttacagtat
     5281 cccctagaaa cgctccaggt gaaatactat ggagcgcgcc cctaggccct gacctaaatc
     5341 cctacctatc ccatttggcc agaatgtaca atggttatgc aggtggtttt gaagtgcagg
     5401 taattctcgc ggggaacgcg ttcaccgccg ggaagatcat atttgcagca gtcccaccaa
     5461 attttccaac tgagggctta agtcctagcc aagtcactat gttcccccat ataatagtag
     5521 atgttagaca attagaacct gtgctgattc ccttacccga tgttaggaat aatttctatc
     5581 attataatca gtcaaatgac tccactatta agttgatagc aatgttgtat acaccactta
     5641 gggctaataa tgctggggat gatgttttca cagtttcgtg ccgagttctc acgagaccat
     5701 cccccgattt tgatttcata tttttagtgc cacccacagt tgagtcaaga actaaaccat
     5761 tctctgtccc agttttaact gttgaggaga tgaccaattc aagattcccc attcctttgg
     5821 aaaagttgtt cacgggcccc agcagtgcct ttgttgtcca accacaaaac ggcaggtgca
     5881 caactgatgg cgtgctccta ggcaccactc aactgtctcc tgttaacatc tgcaccttca
     5941 gaggggatgt cacccacatc acaggtagtc gcaactacac aatgaatttg gcttctcaaa
     6001 attggaataa ttatgaccca acagaagaaa tcccagcccc tctaggaact ccagattttg
     6061 tggggaagat tcaaggcatg ctcacccaaa ccacaaggac agatggttca acacgcggcc
     6121 acaaagctac agtgtacact gggagcgccg actttgctcc aaaactgggt agagttcaat
     6181 ttgaaactga cacagaccat gattttgaag ctaatcaaaa cacaaagttc accccagtcg
     6241 gtgtcatcca agacggtagc accacccacc gaaacgaacc ccaacagtgg gtgctcccaa
     6301 gttactcagg cagaaatacc cacaatgtac acctggcccc cgctgtagcc cccacctttc
     6361 cgggtgagca acttctcttc ttcagatcca ccatgcccgg atgcagcggg taccccaaca
     6421 tggatttgga ctgtctgctc ccccaggaat gggtgcagta tttctaccaa gaggcagccc
     6481 cagcacaatc tgatgtggct ctgctaagat ttgtaaatcc agacacaggt agggttttgt
     6541 ttgagtgcaa gcttcacaaa tcaggctatg ttacagtggc tcacactggc caacatgatt
     6601 tggttatccc tcccaatggt tactttaggt ttgattcctg ggtcaaccag ttctacacgc
     6661 ttgcccccat gggaaatgga acggggcgta gacgtgtagt ataatggctg gagctttctt
     6721 tgctggattg gcatctgatg tccttggctc tggacttggt tccctcatca atgctggggc
     6781 tggggccatc aaccaaaaag ttgagtttga aaataacaga aaattgcaac aagcatcctt
     6841 ccaatttagc agtaatctgc aacaggcttc ctttcaacat gataaagaga tgctccaagc
     6901 acaaattgag gccaccaaaa agctacaaca ggaaatgatg aaagttaagc aggcagtgct
     6961 cctagagggt gggttctctg agacagatgc agcccgcggg gcaattaacg cccccatgac
     7021 aaaagctttg gattggagcg ggacaaggta ctgggctccc gatgctagga ctacaacata
     7081 caatgcaggc cgcttttcca cccctcaacc atcgggggca ctgccaggaa gagctaatct
     7141 tagggatgct gtccctgctc ggggaccctc caacaaatct tctaactctt ctactgtcac
     7201 ctctgtgtac tcaaatcaaa ctatttcaac gagacttggt tctacagctg gttctggaac
     7261 cagtgtctcg agccccccgt caactgcaag gactaggagc tgggttgagg atcaaagtag
     7321 gaatttgtca cctttcatga ggggggccca caacatatca tttgtcaccc caccatctag
     7381 cagatcctct agccaaggca cagtctcaac cgtgcctaaa gagattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgtaagc gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaactgat tatctttctt tttctttagt gt
//