Typing tool

Complete norovirus genomes

MK764041  GII.12
 GII.P16

Length: 7,480 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7471
LOCUS       MK764041                7480 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2018/GII.P16-GII.12/Cambria0311
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK764041
VERSION     MK764041.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7480)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7480)
  AUTHORS   Barclay,L., Cannon,J.L., Bryant,P., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7480
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Cambria0311"
                     /isolate="Hu/US/2018/GII.P16-GII.12/Cambria0311"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="17-Jan-2018"
                     /note="genotype: GII.P16-GII.12"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX92756.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNASVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKPEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPTGITEAFGVPIKQVQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6692
                     /gene="ORF2"
     CDS             5085..6692
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX92757.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPVLTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATHSTKFTPKLGAVQIGTWEQDDVHINQPTKFTPVGLFEN
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6692..7471
                     /gene="ORF3"
     CDS             6692..7471
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX92758.1"
                     /translation="MAGAFIAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGATKTTAFSGGFTSASHARTVDLTKKTSATPAPMPVSRPSSNASTVSTRSTL
                     ISGSSNSPASARSSSSVSSQPTSSSSRTSEWVRSQNRALEPYMNGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWSSAFNTHRQPLFAHLRRRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttctacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaactcca gagttggtca agaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggaa gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactac ggcctgtacg tggagaaagg cttagtgttg ggtgtacaca aaccacctgc
      481 agccataagc atggcaaaag tggagctgac gccgctgtca ttgtattggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcattccc
      601 ttacaccgct tttgacaaca actgctatgc cttttgctgc tgggtattag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattgttcac tagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga atatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctcta atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac ttggggatta cgagttgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtga tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgcaaag accttggtgc
     1141 ctatggctta gagatactca aattggtcat gaaatggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggacgctgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcat tagttcacag
     1441 ggccaaggaa gagctatcta gcaggatgag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga agtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg acacgtgtcc cctcacctta aattgtgaca gaattgaaaa
     1741 taaaggaaaa gtttttgaca gtgaagtcat aataatcaca acaaaccttg ccaatccagc
     1801 cccgcttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gatgtggaaa aggcaaaacg ggacttccct ggtcagccag atatgtggaa
     1921 ggacgccttc aaatcggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaaaaac ggcaacaccc cacatgggaa aggggtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgcgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcctacaatc accaccttca atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggac tggtggacac catgaaagtc ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagagctca aacaagcaat caggaatgtg accatcaaga ggtgccggat
     2281 catctacggt ggctccacat atgaccttga atctgatggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacgcctctg tacagaccaa caatgagttg gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa gtgtgtgcaa gaagcagtct attctatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga atatacaaga
     2521 actctggtcg aagccacaat tggatcaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gccagaagat gacgagttcg tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaataaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggaatatctt caagacagag acaggtacta tgaagaactc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagataaa aatccgtcag agaattttcc gtcctaccag
     2881 gaaacaaagg aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagttgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg attttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ttttggttct ggctggggct tctgggtatc accaagcctg ttcataacat caactcatgt
     3121 aatccccaca ggcataacag aagcatttgg agtccccatc aaacaagttc aaatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggcatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggag actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatc ctaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagcct gcctacctcg gcggccgtga
     3721 cccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ctccaagacc aagtgtgttg gaagcagcca aacaaaccat
     3841 catcaatgtc cttgagcaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca catccagcgg tcacccctat cacgttcgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaagcaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatacaaat atcactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactggcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctact ggcccctagt gtagtagatg taggagactt
     4441 taaaatcaca ataaatgagg ggctcccctc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcactaagc tgtcacctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccccgaac agttaaccgc caaattgaag gagtacggcc taaaaccaac
     4681 ccgcccagac aaaaccgagg gacccctgat catcagtgaa gatttgaacg gactcacttt
     4741 cctccgaaga acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tctcaaaggc ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgcag ccggtctcgt accagaggtc aacaatgaga
     5161 ccatggcact tgaaccggtg gctggggctt cgatagccgc cccactcacc ggccaaaata
     5221 atgttataga cccctggatt agattaaatt ttgtgcaggc ccctaatgga gagtttacag
     5281 tctcaccccg caactcgcct ggggaagtcc tactcaattt ggaattaggt cccgaattga
     5341 atccatattt ggcacacctt tctagaatgt ataatggtta tgcaggtgga gttgaagtgc
     5401 aagtgctact ggctgggaac gcgttcacgg ctggaaaatt ggtatttgct gcagttcccc
     5461 ctcattttcc attagagaat ataagccctg gtcaaataac catgttccct catgtaatta
     5521 ttgatgttag gactttggaa ccagttttat tgcctctacc agatgtcaga aataacttct
     5581 tccattacaa tcaacaaaat gagccgagga tgaggcttgt tgcaatgctt tatacccctc
     5641 ttagatctaa tggttctggt gatgatgtgt tcaccgtctc ctgtagggtg ctcactcgac
     5701 cctctcctga ttttgatttt aattatctgg tgcccccaac agttgaatct aaaacaaaac
     5761 cattcacact ccctgtcttg accattgggg agttaaccaa ttccaggttc cctgtgccca
     5821 tagatgaact ctacactagc cccaatgaga gtttggtggt tcaaccccag aacgggaggt
     5881 gcgcgctgga tggggagttg cagggcacca cccagctcct tcccacggcg atttgctcgt
     5941 tcaggggtcg gatcaatcag aaagtgagtg gagagaatca tgtttggaac atgcaagtca
     6001 ccaacattaa cggaacccct tttgatccaa cagaggatgt tccagcccct ctgggcacgc
     6061 cagacttttc tggcaagctc tttggtgtcc taagccagag ggaccatgat aatgcctgca
     6121 ggagtcatga tgcagtgatt gcaactcatt ccaccaagtt taccccaaaa ttgggtgctg
     6181 tacaaattgg cacgtgggaa caagatgatg tacacatcaa tcaacccacc aagtttactc
     6241 cagttggatt gtttgagaat gaaggtttta atcaatggac acttcctaat tattctggag
     6301 ctttaacact caatatgggg ttggcccccc ctgtggcccc cacatttcct ggtgagcaaa
     6361 ttctcttctt caggtcccac attcccctta aaggaggtgt tgcagaccca gttattgatt
     6421 gtcttctacc ccaagagtgg atccaacact tgtatcagga gtcagcccct tcacaaacag
     6481 atgtggcact gattagattc acaaatccag acacagggcg tgtcctattt gaagcaaaat
     6541 tgcacaggag tggctacatc acagtggcca acactggtag cagaccaatt gtggtgccag
     6601 ctaatggtta tttcaggttt gactcttggg ttaatcagtt ttactctctt gcccccatgg
     6661 gaactgggaa tgggcgcaga aggatgcagt aatggctgga gctttcatag cagggcttgc
     6721 cggtgacata gtcaccaata gcattggctc actcgtgaac gctggggcca atgcaataaa
     6781 ccagaaagta gactttgaaa acaacaagca actacaacag gcatctttca accatgacaa
     6841 agagatgttg caagctcaaa ttcaggccac caaacagcta caggctgata tgattgcaat
     6901 cagacaaggg gtgttgaccg caggcggctt ctcccctact gatgcagcaa gaggtgcagt
     6961 caacgcgccc atgactcaag tcttggattg gaatgggacc agacattggg cccccggagc
     7021 cacgaaaaca actgctttct ccggtgggtt taccagtgcc tctcatgcca ggaccgttga
     7081 cctgaccaag aaaacatcag ccacaccagc ccctatgcct gtttctaggc ccagttctaa
     7141 tgcttccact gtttctactc gctctacttt gattagtggg tcctctaatt ctcctgcttc
     7201 agctaggagc tcttctagcg tttcttccca acccacttcc tcatcctccc gaactagtga
     7261 gtgggtacgc agtcaaaata gggcgctgga gccttatatg aatggggcgc tgcgtacagc
     7321 ctacgtgacg cctccatcca gtagggcttc tagcaatggc acagtctcaa ccgtgccaaa
     7381 agaggttttg gactcctggt cgtctgcgtt caatacacac agacagccgc tgtttgctca
     7441 tctccgtcgg agaggggagt cacaagctta gtgaaaagat
//