Typing tool

Complete norovirus genomes

MK764040  GII.2
 GII.P2

Length: 7,529 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       MK764040                7529 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Cambria0299, complete
            genome.
ACCESSION   MK764040
VERSION     MK764040.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7529)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7529)
  AUTHORS   Barclay,L., Cannon,J.L., Bryant,P., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7529
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Cambria0299"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Cambria0299"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="24-Feb-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            5..5101
                     /gene="ORF1"
     CDS             5..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX92755.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDSLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELSMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYHSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLIARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIGKCQIVYGGNTYTLESDGKGKVVVERVQSTSVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLTEEADEATMKEGC
                     PKPREEEEFVVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDKGTYCGAPILGP
                     GNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHWN
                     GESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDLA
                     TMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWDS
                     TQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLRE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGPN
                     HEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6710
                     /gene="ORF2"
     CDS             5082..6710
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX92753.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNTEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPVNGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX92754.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTAYSGRFTSTAPVRQADFQHTQSRPTSGSSVSSFATQSSRPTLTTTT
                     GSSLGTASSNSTRSTNLSQSTVSRAASRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgttaaca gcaacaacga
       61 caacacaaaa tcttcaagtg acggaatgct taacaacatg gccgtcaccc ttaaacgagc
      121 ccttggggcc cggcccaaac agccggcccc gagggagaaa cccccaagac cccctagacc
      181 accaacacca gaattgatca aaagaatccc ccccccacca cccaatgatg gggacgaacc
      241 aaccgtgatg tttagcactg taggtggcgt gtctggtcta cctgagctca caacagttgg
      301 ccaaccacct gaagctaaca cggcctttag tgtgcctccc ctcagccaaa gggagaatag
      361 ggacgctaag gaaccgttaa ctggaaccat tctggaaatg tgggatgggg agatttatca
      421 ttatggactg tatgtggaaa gagggcttgt gttaggcgtg cacaagccgc cggctgccat
      481 cagcatagcc aaagtggagt taacgcccct ctcactgtac tggagacctg tttacacgcc
      541 tcagtacctt atatctcccg actccttgag gaaactccat ggtgaattgt ttccctacac
      601 agcctttgaa aacaactgtt atgctttctg ctgttgggtt ttggatctta acgattcatg
      661 gctaagcagg aggatgatta gtaggactac tggctttttc aggccctacc aggagtggaa
      721 caggaagccc ctcccaacta tggatgactc aaaattgaag aaggtcgcaa acatcgttct
      781 gtgtgcattg tcatcactgt tcactagacc cattaaggac ataattggca aactcaaacc
      841 cctcaacatc ctaaatatcc tggcctcatg tgactggacc tttgctggca tagtggagtc
      901 actaatcctc ttggctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcaccc ctcctcggtg actacgagct gcaaggcccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gttatgggtg ggataggctt ggtgttggga ttcaccaaag agaaaatagg
     1081 taagatgctc tcctctgcag cgtcaactct gagggcatgt aaagatcttg gagcctacgg
     1141 gttggagatc ctaaaactag tcatgaaatg gtttttccca aagaaagatg aggccaacga
     1201 actgtctatg gttagagcca ttgaagacgc tgtactagac ctggaggcaa ttgagaacaa
     1261 ccatatgacc actctattga aagacaagaa cagccttgca gcctacatga agaccttgga
     1321 catggaagag gaaaaagcca ggaaactatc caccaaatca gcctcccctg acattgtggg
     1381 caccataaac gccctactgg ctaggatcgc tgccgcacgt tccttagttc atagggccaa
     1441 ggaggagctc tccagtagac caagaccagt cgttctgatg atctctggca aaccagggat
     1501 aggaaagacc catctggcca gagaattggc aaagaaaatt gcatcaacac tcacaggaga
     1561 ccaaagggtg ggtcttatcc cacggaatgg agttgaccat tgggacgcct acaaaggtga
     1621 gagagtggtg ctctgggatg actacggtat gagcaatccc atccacgatg cactgaggtt
     1681 gcaggaactg gcagacacat gtccactaac tctgaattgt gacaggattg aaaacaaggg
     1741 gaaagtcttc gacagcgacg cgatcataat cactaccaat ttggtcaatc ccgcgccgct
     1801 ggactatgtc aactttgagg cttgctccag acgtatagac tttcttgtgt atgctgatgc
     1861 cccagaagtc gagaaagcaa agcgggactt ccccggtcaa ccggacatgt ggaaggacgc
     1921 ctatcactct gatttctcac atattaaatt gcaacttgca ccacaaggtg ggtttgacaa
     1981 aaatggcaac accccacatg gtaaaggagt gatgaagact ctcactgcca gttcactgat
     2041 tgcgcgtgcc tctggtctct tgcacgagag attagatgag tacgagttac agggtccgcc
     2101 cctttcaacc ttcaactttg accgcaacaa aattgcagcg ttcagacaac tcgccgctga
     2161 aaataagtat ggtttggtgg acacgatgag ggtgggcaac cagcttagga atgtcacgac
     2221 catggatgaa ctcaagaagg ctatcaaaaa cattataatc gggaagtgcc agatagtcta
     2281 tggcggcaac acttacacgc ttgagtctga cggcaagggc aaggttgttg ttgagagggt
     2341 gcagagcacc agcgtgcaaa ttaacaatga gatcgctggt gcagtgcatc accttagatg
     2401 tgccaggata aggtactatg tcaaatgtgt ccaagaggcc atctactcac tcctccaaat
     2461 cgccggcacg gtgtttgtca cctcacgcat cgtaagccgc atgaacattc aaaatttatg
     2521 gtccagacca ttaactgaag aagcagatga ggcaaccatg aaagaggggt gccctaaacc
     2581 tagggaagaa gaggagtttg tcgtctcttc ggatgacatc aagccagagg gcaagaaagg
     2641 taagaacaag agtggccggg gcaagaaaca cacggcattt tcaagtaaag gtctcagtga
     2701 tgaggagtat gaagagtaca aaaggatcag agaggagaga aacggcaaat actccataga
     2761 ggaataccta caggacagag acaaatacta tgaagaggtg gccattgcca gggcaactga
     2821 agaagacttc tgtgaagaag aagaggttaa gattcgccag aggatcttca ggccaacaag
     2881 aaagcaacgc aaggaagaaa gagccaacct tggcctcgtc accggatctg agatcaggaa
     2941 gaggaatcca gatgacttca aaccaaaagg aaagctgtgg gccgacgatg acaggagcgt
     3001 cgactacaac gaaagaatca gctttgaggc cccaccgagc atttggtcta gaattgttaa
     3061 ctttggttct ggatgggggt tttgggtgtc acccagcctc ttcataacat caacacatgt
     3121 catacctcaa ggtataactg aggcctttgg tgtacccata aggcaggttc aaatacacaa
     3181 atcgggcgaa ttctgtcgtc tgagattccc aaaacccatc aggacggatg tgtcaggtat
     3241 gatactggag gagggagcgc ctgaaggcac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctcttg cagcaagaat gggcacccac gcgaccatga gaatacaagg
     3361 acgcacggtg ggcggccaga tggggatgct gcttactggg tccaacgcaa agagcatgga
     3421 tcttggcacc acgcccggtg actgtgggtg tccctacatt tacaaaaggg gcaacgacta
     3481 catagtcatt ggagtccaca cagcagccgc tcgtggcgga aacactgtca tctgcgccac
     3541 acaaggtagt gaaggtgagg caacactcga gggtggtgat aaaggaacat actgtggggc
     3601 accaatccta ggccccggga acgccccaaa actgagcacc aaaactaagt tctggaggtc
     3661 ctcaactaca ccactcccac ccggcacgta cgagccggca tatctgggag gaaaagaccc
     3721 ccgagtcaaa ggtggaccat ctctgcaaca agttatgcga gaccaactga agccattcac
     3781 tgaaccccgt ggcaagccac caaaaccaag tgtccttgaa gctgctaaaa agacaatcat
     3841 caatgtgcta gaacaaacaa tagacccccc acaaaaatgg acgtacgcgc aagcgtgcgc
     3901 gtcccttgac aaaaccacat ctagtgggtt cccccaccac gtgcgcaaga acgagcactg
     3961 gaatggggaa tctttcacag gaaaattggc tgaccaggca tcaaaagcaa acttaatgtt
     4021 tgaagagggg aagcacatga ctccagttta cacagctgcc cttaaggatg agctggtcaa
     4081 aactgagaag gtgtatggaa aaataaagaa gaggttgctt tggggctctg acctggccac
     4141 catggtgcgg tgcgcgcgct cctttggcgg tctgatggac gaactcaaag cccactgtgt
     4201 gacacttccg ataagggttg gcatgaacat gaatgaagat ggaccaatag tctttgagaa
     4261 acattccaga tataggtatc actatgatgc agactattcc aggtgggact caacacagca
     4321 aagagccgtt ctggccgcgg ccatggagat catggttaaa ttctcagcag aaccacaact
     4381 agcccaaata gttgcagagg atctattgtc gcctagtgta gttgacgtgg gcgacttcaa
     4441 aatttccatc aatgaagggt tgccatcggg tgtcccttgc acctctcagt ggaattccat
     4501 cgcacattgg ctcctcactt tgtgtgccct ctctgaggtc acagacctct ctcctgacat
     4561 tgtacaggcc aactccctct tctccttcta tggagatgat gaaattgtga gcacagatat
     4621 taaattggac ccagaaaaac tgacggggaa gttgagagaa tatggtctca aacctactcg
     4681 tcctgacaaa actgagggcc ccctgattat cagtgaggat ctgaatggcc tgactttcct
     4741 gagaagaacc gtcacccgtg accctgcagg gtggtttggc aaactggacc aaagctccat
     4801 acttaggcaa ttgtattgga ccaagggccc caatcatgaa gacccctttg agtcaatgat
     4861 tccacactcc cagagaccca tacaactcat gtcactcttg ggtgaggcgg cactgcatga
     4921 accgtcattt tacagcaaga tcagcaagct tgtgatatct gaattgaaag aaggtggaat
     4981 ggatttttac gtgcccaggc aagaacccat gtttaggtgg atgagattct cggatttgag
     5041 cacgtgggag ggcgatcgca atcttgctcc cagtcttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaat actgaggtca
     5161 tggctcttga acccgtggct ggtgccgctt tggcagcccc agtcactggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggtgaa tttacagtct
     5281 ccccccgtaa tgcccctggt gaagtgctac taaatctgga gttgggtcca gaattaaatc
     5341 cttatctggc acacttagca agaatgtaca acgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacctc
     5461 acttcccggt tgaaaacctt agtccacaac aaattaccat gttccctcat gtgattatag
     5521 atgtgaggac tttggaacct gtcttattac cactccctga tgttagaaat aatttctttc
     5581 attacaatca gaaggatgat cccaagatga gaattgtggc tatgctttat acccccctta
     5641 gatcaaatgg ctcaggtgat gatgtgttca cagtctcctg tagggtgtta actaggccct
     5701 cccctgactt tgacttcaca tatctggtgc caccaacagt ggagtctaaa acaaagccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc cagattccca gtgtctatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cattggacgg ggagctccaa gggacaacac aactccaggt cagtggcatt tgtgctttca
     5941 agggagaggt aaccgcccac ttgcatgaca atgatcacct atacaatatc accatcacaa
     6001 acttgaatgg atcccctttt gacccctctg aggacatccc tgcccctctg ggcgtacctg
     6061 actttcaggg aagggtcttt ggtattatct cccaaaggga caaacacaat agccctggac
     6121 ataatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtata
     6181 ctccaaaatt gggtcagatt caaattggca catggcagac tgacgatctc actgtcaacc
     6241 aaccagtaaa attcacccca gttggactca atgatactga acattttaac caatgggtgg
     6301 tccccagata tgctggtgcc ctaaacctca acacaaacct tgccccttct gttgccccag
     6361 tatttccagg ggagcgcctg ctctttttca gatcatacat ccccctcaag ggtggctatg
     6421 gaaatccagc cattgattgc ctactaccac aagagtgggt gcaacacttc taccaggaag
     6481 cagccccttc tatgagtgag gtggcccttg tcaggtacat caacccggac actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac ggtctcaagt aacaccagtg
     6601 ccccggtggt tgtacctgtc aatggatact ttaggtttga ctcttgggtg aaccaatttt
     6661 attctctcgc ccccatggga actggaaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttgtggct ggtcttgcag gggacgtgct cagtaatggg ctcagttcac taatcaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcagaaat tacagcaaaa
     6841 ttcttttaat catgacaagg aaatgttgca ggctcagatt caggcaacta agcagctgca
     6901 agcagacatg atggctataa agcagggggt cctgaccgct ggcggctttt cccccgctga
     6961 tgcagccaga ggtgctgtga atgcgcccat gacacaagcg ctggattgga acggcacaag
     7021 gtattgggca ccaggctcca tgaggaccac agcttactct gggagattca catcaaccgc
     7081 cccagtaagg caggccgact ttcagcacac ccaaagccgg cccacgagtg gctcttctgt
     7141 gtcctccttt gccactcagt cttcaagacc aactttgacc acaaccactg ggtcctcact
     7201 tggtacagct tcatcaaatt cgactcgcag tacaaacctc tcccaatcaa cagtttccag
     7261 agctgcatct aggactggtg agtgggttag agaccaaaac agaaatttgg aaccctatat
     7321 gcatggtgcc ttacagacag cctttgtcac cccaccttcc agcagggcgt ctgacgggac
     7381 agtctcaacc gtcccaaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctt tttgcacacc tccgtaagag gggggagtca caagcttagt gaaaaggtga
     7501 aaatctattt agaattaatt gatcttacc
//