Typing tool

Complete norovirus genomes

MK764039  GII.2
 GII.P2

Length: 7,512 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6712
ORF3: 6712..7491
LOCUS       MK764039                7512 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Cambria0298
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK764039
VERSION     MK764039.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7512)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Barclay,L., Cannon,J.L., Bryant,P., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Cambria0298"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Cambria0298"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="24-Feb-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX92750.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDSLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELSMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYHSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLIARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIGKCQIVYGGNTYTLESDGKGKVVVERVQSTSVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLTEEADEATMKEGC
                     PKPREEEEFVVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     4..993
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     994..2091
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2092..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6712
                     /gene="ORF2"
     CDS             5084..6712
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX92751.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNTEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPVNGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6712..7491
                     /gene="ORF3"
     CDS             6712..7491
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX92752.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTAYSGRFTSTAPVRQADFQHTQSRPTSGSSVSSFATQSSRPTLTTTT
                     GSSLGTASSNSTRSTNLSQSTVSRAASRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttct gctgccgctg ctgttaacag caacaacgac
       61 aacacaaaat cttcaagtga cggaatgctt aacaacatgg ccgtcaccct taaacgagcc
      121 cttggggccc ggcccaaaca gccggccccg agggagaaac ccccaagacc ccctagacca
      181 ccaacaccag aattgatcaa aagaatcccc cccccaccac ccaatgatgg ggacgaacca
      241 accgtgatgt ttagcactgt aggtggcgtg tctggtctac ctgagctcac aacagttggc
      301 caaccacctg aagctaacac ggcctttagt gtgcctcccc tcagccaaag ggagaatagg
      361 gacgctaagg aaccgttaac tggaaccatt ctggaaatgt gggatgggga gatttatcat
      421 tatggactgt atgtggaaag agggcttgtg ttaggcgtgc acaagccgcc ggctgccatc
      481 agcatagcca aagtggagtt aacgcccctc tcactgtact ggagacctgt ttacacgcct
      541 cagtacctta tatctcccga ctccttgagg aaactccatg gtgaattgtt tccctacaca
      601 gcctttgaaa acaactgtta tgctttctgc tgttgggttt tggatcttaa cgattcatgg
      661 ctaagcagga ggatgattag taggactact ggctttttca ggccctacca ggagtggaac
      721 aggaagcccc tcccaactat ggatgactca aaattgaaga aggtcgcaaa catcgttctg
      781 tgtgcattgt catcactgtt cactagaccc attaaggaca taattggcaa actcaaaccc
      841 ctcaacatcc taaatatcct ggcctcatgt gactggacct ttgctggcat agtggagtca
      901 ctaatcctct tggctgaact ctttgatgtg ttctggacac ccccagatgt gtctgcaatg
      961 atcgcacccc tcctcggtga ctacgagctg caaggccccg aagacatcgc tgtggagctc
     1021 gtgcccgttg ttatgggtgg gataggcttg gtgttgggat tcaccaaaga gaaaataggt
     1081 aagatgctct cctctgcagc gtcaactctg agggcatgta aagatcttgg agcctacggg
     1141 ttggagatcc taaaactagt catgaaatgg tttttcccaa agaaagatga ggccaacgaa
     1201 ctgtctatgg ttagagccat tgaagacgct gtactagacc tggaggcaat tgagaacaac
     1261 catatgacca ctctattgaa agacaagaac agccttgcag cctacatgaa gaccttggac
     1321 atggaagagg aaaaagccag gaaactatcc accaagtcag cctcccctga cattgtgggc
     1381 accataaacg ccctactggc taggatcgct gccgcacgtt ccttagttca tagggccaag
     1441 gaggagctct ccagtagacc aagaccagtc gttctgatga tctctggcaa accagggata
     1501 ggaaagaccc atctggccag agaattggca aagaaaattg catcaacact cacaggagac
     1561 caaagggtgg gtcttatccc acggaatgga gttgaccatt gggacgccta caaaggtgag
     1621 agagtggtgc tctgggatga ctacggtatg agcaatccca tccacgatgc actgaggttg
     1681 caggaactgg cagacacatg tccactaact ctgaattgtg acaggattga aaacaagggg
     1741 aaagtcttcg acagcgacgc gatcataatc actaccaatt tggtcaatcc cgcgccgctg
     1801 gactatgtca actttgaggc ttgctccaga cgtatagact ttcttgtgta tgctgatgcc
     1861 ccagaagtcg agaaagcaaa gcgggacttc cccggtcaac cggacatgtg gaaggacgcc
     1921 tatcactctg atttctcaca tattaaattg caacttgcac cacaaggtgg gtttgacaaa
     1981 aatggcaaca ccccacatgg taaaggagtg atgaagactc tcactgccag ttcactgatt
     2041 gcgcgtgcct ctggtctctt gcacgagaga ttagatgagt acgagttaca gggtccgccc
     2101 ctttcaacct tcaactttga ccgcaacaaa attgcagcgt tcagacaact cgccgctgaa
     2161 aataagtatg gtttggtgga cacgatgagg gtgggcaacc agcttaggaa tgtcacgacc
     2221 atggatgaac tcaagaaggc tatcaaaaac attataatcg ggaagtgcca gatagtctat
     2281 ggcggcaaca cttacacgct tgagtctgac ggcaagggca aggttgttgt tgagagggtg
     2341 cagagcacca gcgtgcaaat taacaatgag atcgctggtg cagtgcatca ccttagatgt
     2401 gccaggataa ggtactatgt caaatgtgtc caagaggcca tctactcact cctccaaatc
     2461 gccggcacgg tgtttgtcac ctcacgcatc gtaagccgca tgaacattca aaatttatgg
     2521 tccagaccat taactgaaga agcagatgag gcaaccatga aagaggggtg ccctaaacct
     2581 agggaagaag aggagtttgt cgtctcttcg gatgacatca agccagaggg caagaaaggt
     2641 aagaacaaga gtggccgggg caagaaacac acggcatttt caagtaaagg tctcagtgat
     2701 gaggagtatg aagagtacaa aaggatcaga gaggagagaa acggcaaata ctccatagag
     2761 gaatacctac aggacagaga caaatactat gaagaggtgg ccattgccag ggcaactgaa
     2821 gaagacttct gtgaagaaga agaggttaag attcgccaga ggatcttcag gccaacaaga
     2881 aagcaacgca aggaagaaag agccaacctt ggcctcgtca ccggatctga gatcaggaag
     2941 aggaatccag atgacttcaa accaaaagga aagctgtggg ccgacgatga caggagcgtc
     3001 gactacaacg aaagaatcag ctttgaggcc ccaccgagca tttggtctag aattgttaac
     3061 tttggttctg gatgggggtt ttgggtgtca cccagcctct tcataacatc aacacatgtc
     3121 atacctcaag gtataactga ggcctttggt gtacccataa ggcaggttca aatacacaaa
     3181 tcgggcgaat tctgtcgtct gagattccca aaacccatca ggacggatgt gtcaggtatg
     3241 atactggagg agggagcgcc tgaaggcact gttgccacca tactcatcaa aagaaccact
     3301 ggagagctga tgcctcttgc agcaagaatg ggcacccacg cgaccatgag aatacaagga
     3361 cgcacggtgg gcggccagat ggggatgctg cttactgggt ccaacgcaaa gagcatggat
     3421 cttggcacca cgcccggtga ctgtgggtgt ccctacattt acaaaagggg caacgactac
     3481 atagtcattg gagtccacac agcagccgct cgtggcggaa acactgtcat ctgcgccaca
     3541 caaggtagtg aaggtgaggc aacactcgag ggtggtgata ataaaggaac atactgtggg
     3601 gcaccaatcc taggccccgg gaacgcccca aaactgagca ccaaaactaa gttctggagg
     3661 tcctcaacta caccactccc acccggcacg tacgagccgg catatctggg aggaaaagac
     3721 ccccgagtca aaggtggacc atctctgcaa caagttatgc gagaccaact gaagccattc
     3781 actgaacccc gtggcaagcc accaaaacca agtgtccttg aagctgctaa aaagacaatc
     3841 atcaatgtgc tagaacaaac aatagacccc ccacaaaaat ggacgtacgc gcaagcgtgc
     3901 gcgtcccttg acaaaaccac atctagtggg ttcccccacc acgtgcgcaa gaacgagcac
     3961 tggaatgggg aatctttcac aggaaaattg gctgaccagg catcaaaagc aaacttaatg
     4021 tttgaagagg ggaagcacat gactccagtt tacacagctg cccttaagga tgagctggtc
     4081 aaaactgaga aggtgtatgg aaaaataaag aagaggttgc tttggggctc tgacctggcc
     4141 accatggtgc ggtgcgcgcg ctcctttggc ggtctgatgg acgaactcaa agcccactgt
     4201 gtgacacttc cgataagggt tggcatgaac atgaatgaag atggaccaat agtctttgag
     4261 aaacattcca gatataggta tcactatgat gcagactatt ccaggtggga ctcaacacag
     4321 caaagagccg ttctggccgc ggccatggag atcatggtta aattctcagc agaaccacaa
     4381 ctagcccaaa tagttgcaga ggatctattg tcgcctagtg tagttgacgt gggcgacttc
     4441 aaaatttcca tcaatgaagg gttgccatcg ggtgtccctt gcacctctca gtggaattcc
     4501 atcgcacatt ggctcctcac tttgtgtgcc ctctctgagg tcacagacct ctctcctgac
     4561 attgtacagg ccaactccct cttctccttc tatggagatg atgaaattgt gagcacagat
     4621 attaaattgg acccagaaaa actgacgggg aagttgagag aatatggtct caaacctact
     4681 cgtcctgaca aaactgaggg ccccctgatt atcagtgagg atctgaatgg cctgactttc
     4741 ctgagaagaa ccgtcacccg tgaccctgca gggtggtttg gcaaactgga ccaaagctcc
     4801 atacttaggc aattgtattg gaccaagggc cccaatcatg aagacccctt tgagtcaatg
     4861 attccacact cccagagacc catacaactc atgtcactct tgggtgaggc ggcactgcat
     4921 gaaccgtcat tttacagcaa gatcagcaag cttgtgatat ctgaattgaa agaaggtgga
     4981 atggattttt acgtgcccag gcaagaaccc atgtttaggt ggatgagatt ctcggatttg
     5041 agcacgtggg agggcgatcg caatcttgct cccagtcttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctactg atggtgcagc cggcctcgtg ccagaaagta atactgaggt
     5161 catggctctt gaacccgtgg ctggtgccgc tttggcagcc ccagtcactg gtcaaacaaa
     5221 tattatagac ccttggatta gagcaaattt tgtccaggcc cccaatggtg aatttacagt
     5281 ctccccccgt aatgcccctg gtgaagtgct actaaatctg gagttgggtc cagaattaaa
     5341 tccttatctg gcacacttag caagaatgta caacgggtat gccggtggga tggaggtgca
     5401 ggtcatgttg gctgggaacg cgttcacagc cggcaagttg gtcttcgccg ccgtgccacc
     5461 tcacttcccg gttgaaaacc ttagtccaca acaaattacc atgttccctc atgtgattat
     5521 agatgtgagg actttggaac ctgtcttatt accactccct gatgttagaa ataatttctt
     5581 tcattacaat cagaaggatg atcccaagat gagaattgtg gctatgcttt atacccccct
     5641 tagatcaaat ggctcaggtg atgatgtgtt cacagtctcc tgtagggtgt taactaggcc
     5701 ctcccctgac tttgacttca catatctggt gccaccaaca gtggagtcta aaacaaagcc
     5761 attcaccctc ccaatcctca cacttgggga actttccaat tccagattcc cagtgtctat
     5821 agaccagatg tacaccagcc ctaatgaagt tatatcagtg cagtgtcaaa atggtaggtg
     5881 cacattggac ggggagctcc aagggacaac acaactccag gtcagtggca tttgtgcttt
     5941 caagggagag gtaaccgccc acttgcatga caatgatcac ctatacaata tcaccatcac
     6001 aaacttgaat ggatcccctt ttgacccctc tgaggacatc cctgcccctc tgggcgtacc
     6061 tgactttcag ggaagggtct ttggtattat ctcccaaagg gacaaacaca atagccctgg
     6121 acataatgaa ccagcaaaca ggggacacga cgctgtggtc cctacttaca cagcacagta
     6181 tactccaaaa ttgggtcaga ttcaaattgg cacatggcag actgacgatc tcactgtcaa
     6241 ccaaccagta aaattcaccc cagttggact caatgatact gaacatttta accaatgggt
     6301 ggtccccaga tatgctggtg ccctaaacct caacacaaac cttgcccctt ctgttgcccc
     6361 agtatttcca ggggagcgcc tgctcttttt cagatcatac atccccctca agggtggcta
     6421 tggaaatcca gccattgatt gcctactacc acaagagtgg gtgcaacact tctaccagga
     6481 agcagcccct tctatgagtg aggtggccct tgtcaggtac atcaacccgg acactggtcg
     6541 ggcactgttt gaggccaagc tccacagagc tggtttcatg acggtctcaa gtaacaccag
     6601 tgccccggtg gttgtacctg tcaatggata ctttaggttt gactcttggg tgaaccaatt
     6661 ttattctctc gcccccatgg gaactggaaa tgggcgtaga agggttcaat aatggctgga
     6721 gcttttgtgg ctggtcttgc aggggacgtg ctcagtaatg ggctcagttc actaatcaat
     6781 gcaggtgcta atgcaataaa tcagagggca gaatttgatt ttaatcagaa attacagcaa
     6841 aattctttta atcatgacaa ggaaatgttg caggctcaga ttcaggcaac taagcagctg
     6901 caagcagaca tgatggctat aaagcagggg gtcctgaccg ctggcggctt ttcccccgct
     6961 gatgcagcca gaggtgctgt gaatgcgccc atgacacaag cgctggattg gaacggcaca
     7021 aggtattggg caccaggctc catgaggacc acagcttact ctgggagatt cacatcaacc
     7081 gccccagtaa ggcaggccga ctttcagcac acccaaagcc ggcccacgag tggctcttct
     7141 gtgtcctcct ttgccactca gtcttcaaga ccaactttga ccacaaccac tgggtcctca
     7201 cttggtacag cttcatcaaa ttcgactcgc agtacaaacc tctcccaatc aacagtttcc
     7261 agagctgcat ctaggactgg tgagtgggtt agagaccaaa acagaaattt ggaaccctat
     7321 atgcatggtg ccttacagac agcctttgtc accccacctt ccagcagggc gtctgacggg
     7381 acagtctcaa ccgtcccaaa aggtgttttg gactcctgga cacctgcgtt caacacccgc
     7441 aggcagccgc tttttgcaca cctccgtaag aggggggagt cacaagctta gtgaaaaggt
     7501 gaaaatctat tt
//