Typing tool

Complete norovirus genomes

MK764022  GII.2
 GII.P16

Length: 7,533 | 3 CDS

ORF1: 2..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       MK764022                7533 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2018/GII.P16-GII.2/Hanover0423
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK764022
VERSION     MK764022.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7533)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7533)
  AUTHORS   Barclay,L., Cannon,J.L., Dickinson,M.K., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7533
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hanover0423"
                     /isolate="Hu/US/2018/GII.P16-GII.2/Hanover0423"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="06-Feb-2018"
                     /note="genotype: GII.P16-GII.2"
     gene            2..5101
                     /gene="ORF1"
     CDS             2..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX92745.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENKEAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVIMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDTFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNKITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEVVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     2..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6710
                     /gene="ORF2"
     CDS             5082..6710
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX92746.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX92747.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNKNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgctaccgt tgccgttgct tgcaacaaca acaacgacaa
       61 agaaaaatct tcaggtgaag gcttattcac aaatatgtct tccaccttaa agaaagccct
      121 cggggctagg cccaaacagc ctgccccgag agacaaacca caaaagcccc caagaccacc
      181 aactcccgag ttggtcaaga ggataccccc tcctccacct aacggcgaag aagaagaaga
      241 accagtcatt aggtatgagg tcaagagtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccagccg gacgtggcca acacagcatt cagtgttcca ccactgagct tgagagaaaa
      361 caaggaggcc aaggagccac taacaggggc aatactagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 cataagtatg gcaagagtgg agctgacgcc gttgtcattg tactggcgtg tggtgtacac
      541 tccccaatac ctcatctccc ctgaaaccct caggaggctc aacggagagg cgttccctta
      601 caccgccttt gacaacaact gctatgcctt ttgctgctgg gtgttagacc tcaatgactc
      661 atggcttagc aggaggatgg tacaaagaac aacgggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccta ccatggatga ctccaaaatt aagaaggtag caaatatatt
      781 cctatgttca ttgtccacat tattcaccag acccataaaa gacctcatag gaaaaattaa
      841 accattgaac atattgaata tcctggcaac gtgtgactgg acttttgccg gagtagtgga
      901 gtctctgata ttacttgctg aactcttcgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttactcg gggactacga gttgcaaggg ccagaagacc tcgccgttga
     1021 actcgtgccc gtggtaatgg gggggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac actcagggct tgcaaagatc ttggtgccta
     1141 tggtttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aggaggccaa
     1201 tgagctagct atggtgaggg ccatagagga tgctgtatta gaccttgagg caatagaaaa
     1261 taaccacatg acaaccctgt tgaaagacaa agacagctta gcaacataca tgaaaacact
     1321 ggacatggag gaggagaaag ccaggaggtt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacaatc aacgccctgc tggctcgaat agcagcggcc aggtcattag tccacagggc
     1441 caaggaagag ctatctagta ggataaggcc agtagttatt atgatatctg gcaagccagg
     1501 aataggcaaa actcatctgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 agatcaaaga gtcggactca taccacgaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagtaac cctattcatg atgctcttcg
     1681 catacaagaa ttggctgata cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 ggggaaagtt ttcgacagtg aagtcataat aattacaaca aaccttgcca atccagcccc
     1801 acttgattac gtcaactttg aggcctgttc caggagaatt gatttcctgg tgtacgctga
     1861 ggcaccagaa gtagaaaagg caaaacggga ctttcctggt cagccagata tgtggaagga
     1921 caccttcaag ccggactttt cacacatcaa gctacagctt gcaccccagg gcggctttga
     1981 caagaatggc aacaccccac atgggaaagg agtgatgaag accctcacta ccggttctct
     2041 gattgcccgt gcatcaggcc tactgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacaatcacc acctttaatt tcgaccgaaa caaaatcacg gcattcagac aattggctgc
     2161 agaaaacaag tatggattgg tggataccat gaaagttggc aatcaattaa aaggagtgaa
     2221 aaccatggaa gaactcaaac aagcaatcag gaatgtgacc atcaagaggt gccagatcat
     2281 ctacggtggt tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaac acctctgtac agaccaataa cgagttggct ggggccctgc accatctcaa
     2401 acatgcccga atcaggtact atgtcaaatg tgtgcaagaa gtagtctatt ccatcataca
     2461 aattgccggc gctgcgtttg tcaccacgcg catcgcacgc cgcatgaaca tacaagaact
     2521 ctggtcgaag ccacaactag atcaaaatga atcagagact aaggaagagg cccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctcc agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga gaataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggagctcgcc attgccaaag ccacggaaga
     2821 agacttctgt gaggaggagg agatcaaaat ccgtcagaga attttccgtc ccaccaggaa
     2881 acaaagaaag gaagagaggg ccacattagg gctagtaaca ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ccaaagggaa gctgtgggcc gatgacaata ggagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagctt
     3061 tggctctggc tggggcttct gggtgtcacc aagccttttc ataacatcaa ctcatgtaat
     3121 ccccgcaggc ataacagaag cgtttggagt ccccatcaaa caaattcaga tccacaaatc
     3181 aggcgaattt tgccgattca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaactgtg ctcatcaaac gccccaccgg
     3301 agagctcatg cctcttgcag ccagaatggg aacacacgca accatgaaaa ttcaaggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggatca aatgctaaag gaatggactt
     3421 gggaacaact cctggtgact gtggctgtcc ttacatctat aaaaggggca atgactatat
     3481 agtcattggg gtgcacactg cagcagcccg tggtggaaac actgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 acccattcta ggccctgggg gtgcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg cccctcccac cagggacata tgagcctgcc tacctcggtg gccgtgatcc
     3721 gcgtgttaag ggtgggcctt ccctgcagca ggtgatgaga gaccagttga agccattcac
     3781 tgaacccagg ggcaaacctc caagaccaag tgtattggaa gcagccaaac aaaccatcat
     3841 taatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgcgc
     3901 ctcacttgac aaaaccacct ccagcgggca cccccatcac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaactggc agaccaagca tcaaaagcaa acctaatgtt
     4021 tgaggaaggg aaacacatga caccagtgta cacagcggca ctcaaggacg agctagtcaa
     4081 gactgagaaa atttatggaa agatcaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgctaggt catttggtgg gcttatggac gagatgaagg cacactgcat
     4201 atcactccca gtccgagttg gcatgaatat gaatgaagat ggcccaataa tatttgagaa
     4261 acattccaga tacaaatatc actatgatgc agactactct cgttgggatt caacacaaca
     4321 gagggcagtt ctagcagcag ccttggaaat catggtcaga ttctctgcag aaccacaatt
     4381 ggcacaaata gtcgctgagg atctgctggc ccctagtgta gtagatgtag gagactttaa
     4441 aatcacaata aatgaagggc tcccttctgg tgtgccatgc acttctcaat ggaactccat
     4501 cgcacactgg ctgctaactc tctgtgcctt gtctgaagtc accaaactat cccctgacat
     4561 tatacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gtaccgacat
     4621 aaaattggac cctgaacagt taaccgccaa attgaaggag tacggcctga aaccaacccg
     4681 cccagacaaa accgagggac ccctgattat cagtgaagat ttgaacggtc tcactttcct
     4741 ccgaaggacg gtgactcgtg acccagctgg ctggtttgga aaactggacc aaagctcaat
     4801 tttgaggcag atgtactgga ctagaggacc aaatcatgaa gaccccaatg agacaatgat
     4861 accccattcc caaagaccca tacagctcat ggcactgctt ggtgaagcct ctcttcacgg
     4921 accctctttc tacagtaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaac aatgaggtca
     5161 tggctcttga acccgtggct ggtgccgcct tggcagcccc ggtcaccggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggtgaa tttacagtct
     5281 ccccccgaaa tgcccctggt gaagtgctac tgaatctaga gttgggtcca gaattaaatc
     5341 cttatctggc acatttagca agaatgtaca atgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacccc
     5461 acttcccggt tgaaaacctt agcccacagc aaatcaccat gttccctcat gtgatcatag
     5521 atgtgagaac cttggaacct gttttattac cactccctga tgttaggaat aacttcttcc
     5581 attataacca gaaagatgac cccaagatga gaattgtggc tatgctttat acccccctca
     5641 ggtctaatgg ttcaggtgat gatgtgttta cagtctcctg tagggtgttg actagacctt
     5701 cccctgactt tgacttcaca tacctggtgc caccaacagt ggagtctaaa acaaagccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc taggttccca gtgtccatag
     5821 accagatgta caccagccct aatgaaatta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cactggacgg ggagctccaa gggacaactc aactccaagt cagtggcatt tgtgctttca
     5941 aaggtgaagt gaccgcccac ttgcatgaca atgatcacct atataatgtc accatcacaa
     6001 acttgaatgg gtcccctttt gatccctccg aggatatccc tgcccctttg ggtgtgcctg
     6061 acttccaggg aagggttttt ggtatcatct cccaaagaga taaacacaat agtcctgggc
     6121 ataatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtaca
     6181 ctccaaaact tggacaaatt caaattggca catggcaaac tgacgacctt acagtcaacc
     6241 agccagtcaa attcacccca gttggactca atgacactga acactttaac caatgggtgg
     6301 tccctaggta tgctggtgcc ctaaacctca atacaaacct tgccccttct gttgctccag
     6361 tatttccagg agagcgcctg ctcttcttca gatcatacat tcccctcaag ggcggttatg
     6421 gaaacccagc cattgattgc ctactaccac aagagtgggt gcagcacttc tatcaggaag
     6481 cagccccttc aatgagtgag gtggccctcg tcagatacat caacccggac actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac agtctcgagc aacaccagtg
     6601 ccccggtggt tgtgcctgcc aacgggtact tcagatttga ttcttgggtg aaccaatttt
     6661 actctctcgc ccccatggga actgggaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttgtagct ggtcttgcag gggacgtgct cagcaatggg cttagttcat taatcaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcaaaaat tgcagcaaaa
     6841 ttcttttaat catgataagg agatgttgca ggctcagatt caggcaacta agcagctgca
     6901 ggcagacatg atggctataa aacaaggggt cttgaccgct ggcggctttt cccctgctga
     6961 tgcagccaga ggtgctgtga acgcgcccat gacacaggcg ctggattgga atggcacaag
     7021 gtattgggct ccaaactcca tgaggaccac atcttattct ggaaaattca catcaaccgc
     7081 cccagtgagg caggctgact tccagcacac ccaaagccgg ccttcgagtg gctcctctgt
     7141 gtcctccttt gccactcagt cttcaaggcc aactctgacc acaaccactg gttcctcaca
     7201 tggcacagcc tcatcaaatt caactcgcag cacaagcctc tcccaatcaa cggtctccag
     7261 agctacatct agaactggtg agtgggttag agatcaaaat aaaaatttgg aaccctacat
     7321 gcatggtgcc ttacagacag cctttgtcac cccaccttcc agcagggcat ctgacggaac
     7381 agtctcaacc gtccctaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctt tttgcacacc tccgtaagag gggggagtca caagcttagt gaaaaggtga
     7501 aaatttattt aggattaatt gattttacct ttt
//