Typing tool

Complete norovirus genomes

MK764021  GII.4 Sydney
 GII.P16

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       MK764021                7536 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.4 Sydney/Loudoun0411
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK764021
VERSION     MK764021.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Barclay,L., Cannon,J.L., Dickinson,M.K., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Loudoun0411"
                     /isolate="Hu/US/2017/GII.P16-GII.4 Sydney/Loudoun0411"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="20-Jul-2017"
                     /note="genotype: GII.P16-GII.4 Sydney"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX92742.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEGEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTNTTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSRPQLDQNESEAKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEENFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSRISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6707
                     /gene="ORF2"
     CDS             5085..6707
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX92743.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     gene            6707..7513
                     /gene="ORF3"
     CDS             6707..7513
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX92744.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQSQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARITTYNAGHFSTPQPSRALPGRANLRDAVPARGPSNKSS
                     NSSTATSVYSNQTISTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacgaa ccacaaaagc ccccaagacc
      181 accaactccc gagctggtca agagaatacc ccctcctcca cctaatggcg aagaagaagg
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtc ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg acggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agccataagc atggcaagag tggagctgac gccgctgtca ttgtactggc gtgtggtgta
      541 caccccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcgtttcc
      601 ttacaccgcc ttcgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ccaccatgga tgactccaag ataaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac tagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga acatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgagttgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtga tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgcaaag atcttggtgc
     1141 ctatggctta gagatactca aattggttat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgaacta gccatggtga gggccataga ggatgccgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgttggctcg aatagcagca gccaggtcat tagtccacag
     1441 ggccaaggaa gagttatcta gcaggataag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggttgcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcgtacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 taagggaaag gtttttgaca gtgaagtcat aataattaca acaaaccttg ccaacccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggatttccct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggggtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcccacaaac accaccttta atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggat tggtggatac catgaaagtt ggcaatcaac taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtg accatcaaga ggtgccggat
     2281 catctacggt ggctccacgt atgaccttga atctgatggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tacagaccaa caacgagttg gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attccatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg agaccacaat tagatcaaaa tgaatcagag gctaaggaag aggcccccaa
     2581 gtcagaagat gacgagttca tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaaaacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctggta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtatc accaagcctg ttcataacat caactcatgt
     3121 aatccccgca ggcataacag aagcatttgg agtccccatc aaacaaattc agatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgaaggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggtg actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ttaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagcct gcctacctcg gtggccgtga
     3721 cccgcgtgtt aagggtggac cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 tatcaatgtt ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcatccccat cacgtccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa aaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtgcgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaagcactcc agatacaaat accactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactagcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctact ggcccctagt gtagtagatg taggagactt
     4441 taaaatcaca ataaatgaag ggctcccatc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tgtcccctga
     4561 cattatacaa gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaactg gaccctgaac agttaaccgc caagttgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aagaccgagg gacccctgat catcagtgaa gatttgaacg gactcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagttc
     4801 aatattgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccac tctcaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta gaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt accagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtggg gagtttacag
     5281 tgtcccctag aaacgctcca ggtgaaatac tatggagcgc gcccctaggc cctgacctaa
     5341 atccctacct atcccatttg gctagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaagat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttaagcccta gccaggttac tatgttcccc catataatag
     5521 tagatgttag acaattagaa cctgtgctga ttcccttacc tgatgttagg aataattttt
     5581 atcattataa tcagtcaaat gactctacta ttaagttgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctgga gatgatgttt tcacagtttc gtgccgggtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ttcaagattc cccatccctt
     5821 tggaaaagtt gttcacaggc cccagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacaactga tggcgtgctc ctaggcacca cccaactttc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac atcacaggta gtcgcaacta cacaatgaat ttggcttctc
     6001 aaaattggaa caactatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 ttgtggggaa gattcagggc atgctcaccc aaaccacaag ggcagacggt tcaacacgcg
     6121 gccacaaagc tacagtgtac actgggagtg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgaaac tgacacagac catgattttg aagctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaagatggt agcaccaccc accgaaacga accccaacag tgggtgctcc
     6301 caagttactc aggcagaaat actcacaatg tacatttggc ccccgctgta gcccccacct
     6361 ttccgggtga gcaacttctc ttcttcagat ccaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca gtacttctac caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg caagcttcac aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttacttta ggtttgattc ctgggtcaac cagttctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgtgt agtataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctta tcaatgccgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcatc
     6841 cttccaattt agcagcaatc tgcaacaggc ttcctttcaa catgataaag agatgcttca
     6901 atcacaaatt gaggccacca aaaagctaca acaggaaatg atgaaagtta agcaggcaat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgc ggggcaatta acgcccccat
     7021 gacaaaaact ttggattgga gcgggacaag gtactgggcc ccagatgcta ggattacaac
     7081 atacaatgca ggccactttt ccacccctca accatcgagg gcactgccag gaagagctaa
     7141 tcttagggat gctgtccctg ctcggggacc ctccaacaaa tcttctaact cttctactgc
     7201 cacctctgtg tactcaaatc aaactatttc aacgagactt ggttctacag ctggttctgg
     7261 aactagtgtc tcgagcctcc cgtcaaccgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcatttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagagattt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgggggga
     7501 gtcacgggtg taatgtgaaa agacaaaact gattat
//