Typing tool

Complete norovirus genomes

MK762633  GII.2
 GII.P16

Length: 7,519 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MK762633                7519 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.2/NewYork0199
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK762633
VERSION     MK762633.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7519)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7519)
  AUTHORS   Barclay,L., Cannon,J.L., Patel,P., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7519
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="NewYork0199"
                     /isolate="Hu/US/2017/GII.P16-GII.2/NewYork0199"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="29-Oct-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX91126.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGVSGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRRQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVSIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMRIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLRPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGRIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKVSKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX91127.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFVTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX91128.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQVQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTN
                     GFSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaagaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc aggcccaaac agcctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca agaggatacc ccctcctcca cctaacggcg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tggggtctct ggcctgcccg agctcacaac
      301 agtcccccaa ccggacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggagc cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agccataagc atggcaagag tggagctgac gccgttgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac cctcaggagg ctcaacggag aggcattccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtacaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagatctca taggaaaaat
      841 taaaccattg aacatattga atatcctggc aacgtgtgac tggacttttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgagttgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggggggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgcaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gctatggtga gggccataga ggatgctgta ctagaccttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccaggag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctatcta gtaggatgag gccagtagtt gttatgatat ctggcaagcc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccacg aaacggtgtg gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccctattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 taagggaaaa gtttttgaca gtgaagtcat aataattaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggactttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacccc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 ccccacaatc accaccttca atttcgaccg aaacagaatc acggcattca gacaattggc
     2161 tgcagaaaac aagtatggat tggtggatac catgaaagtt ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtg accatcaaga ggtgccagat
     2281 catctacggt ggttccacgt atgaccttga atctgacggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tacagaccaa taacgagttg gctggggccc tgcaccatct
     2401 caaacatgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attccatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gtcagaagat gacgagttta tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaggcaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acaggagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ctttggctct ggctggggct tctgggtgtc accaagcctt ttcataacat caactcatgt
     3121 aatccccgca ggcataacag aagcatttgg agtctccatc aaacaaattc agatccacaa
     3181 atcaggcgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga gaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 cttgggaaca actcctggtg actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacactgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctgggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgagccc gcctacctcg gtggccgtga
     3721 tccgcgtgtt aagggtgggc cttccctgca gcaggtgatg agagaccagt tgaggccatt
     3781 cactgaaccc aggggaaaac ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 catcaacgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcacccccat cacgtccgaa agaatgaatt
     3961 ctggaatgga gagaccttca ctggtaaact ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtacacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaggatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggcttatg gacgagatga aggcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatacaaat atcactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gttctagcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaattaca ataaatgaag ggctcccttc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tgtcccctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagtaccga
     4621 cataaaattg gaccctgaac agttaaccgc caaattgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aaaaccgagg gacccctgat tatcagtgaa gatttgaacg gtctcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg gccaaatcat gaagacccca atgagacaat
     4861 gataccccat tcccaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aagtcagtaa gttggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aacaatgagg
     5161 tcatggctct tgaacccgtg gctggtgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tctctccccg aaatgcccct ggtgaagtgc tactgaatct agagttgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaatgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gccgtgccac
     5461 cccacttccc ggttgaaaac cttagcccac agcaaatcac catgttccct catgtgatca
     5521 tagatgtgag aaccttggaa cctgttttat taccactccc tgatgttagg aataacttct
     5581 tccattataa ccagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 tcaggtctaa tggttcaggt gatgatgtgt ttacagtctc ctgtagagtg ttgactagac
     5701 cttcccctga ctttgacttc acatacctgg tgccaccaac agtggagtct aaaacaaagc
     5761 cattcaccct cccaatcctc acacttgggg aactttccaa ttctaggttc ccagtgtcca
     5821 tagaccagat gtacaccagc cctaatgaaa tcatatcagt gcagtgtcaa aatggtaggt
     5881 gcacactgga cggggagctc caagggacaa cacaactcca agtcagtggc atttgtgctt
     5941 tcaaaggtga agtgaccgcc cacttgcatg acaatgatca cctatataat gtcaccatca
     6001 caaacttgaa tgggtcccct tttgatccct ccgaggatat ccctgcccct ttgggtgtgc
     6061 ctgacttcca gggaagggtt tttggtatca tctcccaaag agataaacac aatagtcctg
     6121 ggcataatga accagcaaac aggggacacg acgctgtggt ccctacttac acagcacagt
     6181 acactccaaa acttggacaa attcaaattg gcacatggca aactgacgac cttacagtca
     6241 accaaccagt caaattcacc ccagttggac tcaatgacac tgaacacttt aaccaatggg
     6301 tggtccctag gtatgctggt gccctaaacc tcaatacaaa tcttgcccct tctgttgctc
     6361 cagtatttcc aggagagcgc ctgctcttct tcagatcata cattcccctc aagggcggtt
     6421 atggaaaccc agccattgat tgcctactac cacaagagtg ggtgcaacac ttctaccagg
     6481 aagcagcccc ttcaatgagt gaggtggccc tcgtcagata catcaacccg gacactggtc
     6541 gggcactgtt tgaggccaag ctccacagag ctggtttcgt gacagtctcg agcaacacca
     6601 gtgccccggt ggttgtgcct gccaatgggt acttcagatt tgattcttgg gtgaaccaat
     6661 tttattctct cgcccccatg ggaactggga atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggcttagtt cattaatcaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaaa aattgcagca
     6841 aaattctttt aatcatgata aggagatgtt gcaggctcag gttcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta taaaacaagg ggtcttgacc gctggcggct tttcccctgc
     6961 tgatgcagcc agaggtgctg tgaacgcgcc catgacacag gcgctggact ggaatggcac
     7021 aaggtattgg gcaccaaact ccatgaggac cacatcttat tctggaaaat tcacatcaac
     7081 cgccccagtg aggcaggctg actttcagca cacccaaagc cggccttcga gtggctcctc
     7141 tgtgtcttcc tttgccactc agtcttcaag gccaactctg accacaacca atggtttctc
     7201 acatggcaca gcctcatcaa attcaactcg cagcacaagt ctctcccaat caacggtctc
     7261 cagggctaca tctaggactg gtgagtgggt tagagatcaa aatagaaatt tggaacccta
     7321 catgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg catctgacgg
     7381 gacagtctca accgtcccta aaggtgtttt ggactcctgg acacctgcgt ttaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaattta tttaggatg
//