Typing tool

Complete norovirus genomes

MK762627  GII.12
 GII.P16

Length: 7,504 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6691
ORF3: 6691..7470
LOCUS       MK762627                7504 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.12/Douglas0168
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK762627
VERSION     MK762627.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7504)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7504)
  AUTHORS   Barclay,L., Cannon,J.L., Getz,K., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7504
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Douglas0168"
                     /isolate="Hu/US/2017/GII.P16-GII.12/Douglas0168"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="26-Sep-2017"
                     /note="genotype: GII.P16-GII.12"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX91108.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPLTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTIDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNASVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     ALKPEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPTGITEAFGVPIKQVQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     4..999
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1000..2097
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2098..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6691
                     /gene="ORF2"
     CDS             5084..6691
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX91109.1"
                     /translation="MKMASNDAVPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPVLTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATDSTKFTPKLGAVQIGTWEQDDVHINQPTKFTPVGLFEN
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6691..7470
                     /gene="ORF3"
     CDS             6691..7470
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX91110.1"
                     /translation="MAGAFIAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGATKTTAFSGGFTSASHARTVDLTKKTSATPAPMPVSRPSSITSTVSTRSTL
                     ISGSSNSPSSARSSSSVSSQPTSSSSRTSEWVRSQNRALEPYMNGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWSSAFNTHRQPLFAHLRRRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaggaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaagcc
      121 ctcggggcca ggcccaaaca gcctgccccg agagacaaac cacaaaagcc cccaagacca
      181 ctaactcccg agttggtcaa gaggataccc cctcctccac ctaatggcga agaagaagaa
      241 gaaccagtca ttaggtatga ggttaagagt gggatctctg gcctgcccga gctcacaaca
      301 gtcccccaac cggacgtggc caacacagca ttcagtgttc caccactgag cttgagggaa
      361 aacagggaag ccaaggaacc gctaacaggg gcaatattag agatgtggga tggagagata
      421 taccactacg gcctgtacgt ggagaaaggt ttagtgttgg gtgtacacaa accacctgca
      481 gccataagca tggcaaaagt ggagctgacg ccgctgtcat tgtattggcg tgtggtgtac
      541 actccccaat acctcatctc ccctgaaact ctcaggaggc tcaacggaga ggcattccct
      601 tacaccgcct ttgacaacaa ctgctatgcc ttttgctgct gggtgttaga cctcaatgac
      661 tcatggctta gcaggaggat ggtgcaaaga acaacgggct tcttcagacc ttaccaagag
      721 tggaacagaa aacccctgcc taccatagat gactccaaaa ttaagaaggt agcaaatata
      781 ttcctatgtt cattgtccac attgttcact agacccataa aagacctcat aggaaaaatt
      841 aaaccattaa acatattgaa tatccttgca acgtgtgact ggacgtttgc cggaatagtg
      901 gagtctctaa tattacttgc tgaactcttc ggagttttct ggacaccccc agatgtgtct
      961 gctatgatcg ctcccttact tggggattac gagttgcaag ggccagaaga cctcgccgtt
     1021 gaactcgtac ctgtggtgat gggagggatt ggtttggtgt tgggattcac caaagagaaa
     1081 attggcaaaa tgttgtcctc agcagcatca acactcaggg cttgcaaaga ccttggtgcc
     1141 tatggcttag agatactcaa attggtcatg aagtggttct tcccaaagaa agaggaggcc
     1201 aatgagctag ccatggtgag ggccatagag gacgctgtac tagatcttga ggcaatagaa
     1261 aataaccaca tgacaaccct gttgaaagac aaagacagct tagcaacata catgaaaaca
     1321 ctggacatgg aggaggagaa agccagaagg ttgtccacaa aatctgcatc ccctgacata
     1381 gttgggacaa tcaacgccct gctggctcga atagcagcgg ccaggtcatt agtccacagg
     1441 gccaaggaag agctatctag caggatgaga ccagtagttg ttatgatatc tggcaaacca
     1501 ggaataggca aaactcatct ggccagggaa gtggcaagaa aggtggcatc cactctcaca
     1561 ggggatcaaa gagtcggact cataccaaga aacggtgtgg accattggga tgcatacaaa
     1621 ggtgagagag tcgtgctgtg ggacgactat ggcatgagta accccattca tgatgctctt
     1681 cgcatacaag aattggctga tacgtgtccc ctcaccttaa attgtgacag aattgaaaat
     1741 aaaggaaaag tttttgacag tgaagtcata ataatcacaa caaaccttgc caatccagcc
     1801 ccacttgatt atgtcaactt tgaggcctgt tccaggagaa ttgatttcct ggtgtacgct
     1861 gaggcaccag atgtggaaaa ggcaaaacgg gactttcctg gtcagccaga tatgtggaag
     1921 gacgccttca aatcggactt ttcacacatc aagctacagc tcgcacctca gggcggcttt
     1981 gacaaaaacg gcaacacccc acatgggaaa ggggtgatga agaccctcac taccggttct
     2041 ctgattgccc gcgcatcagg cctactgcat gagaggatgg atgaatttga actccaaggt
     2101 cctacaatca ccaccttcaa tttcgaccgg aacagaatca cagcatttag acaattggct
     2161 gcagaaaaca agtatggact ggtggacacc atgaaagtcg gcaatcaatt aaaaggagtg
     2221 aaaaccatgg aagagctcaa acaagcaatc aggaatgtga ccatcaagag gtgccggatc
     2281 atctacggtg gatccacata tgatcttgaa tctgatggca agggcaaagt tttggtggaa
     2341 aaggtcaaga acgcctctgt acagaccaac aacgagttgg ccggggccct gcaccatctc
     2401 aaacacgccc gaatcaggta ctatgtcaag tgtgtgcaag aagcagtcta ttctatcata
     2461 caaattgccg gcgctgcgtt tgtcaccacg cgcattgcac gccgcatgaa catacaagaa
     2521 ctctggtcga agccacaatt ggatcaaaat gaatcagaga ctaaggaaga ggccctcaag
     2581 ccagaagatg acgagttcgt catatcttct aaggacatca aggaggaagg aaagaagggc
     2641 aaaaataaaa ctggccgtgg caagaaacac actgcattct ccagcaaggg cttgagcgat
     2701 gaggagtatg acgagtacaa gaggataaga gaagagagaa atgggaagta ctctatagag
     2761 gaatatcttc aagacagaga caggtactat gaagaactcg ccattgccaa ggccacggaa
     2821 gaagacttct gtgaagagga ggagataaaa atccgtcaga gaattttccg tcctaccagg
     2881 aaacaaagga aggaagagag ggccacatta gggctagtaa caggttcaga aatcagaaaa
     2941 agaaaccctg atgacttcaa acccaaaggg aagctgtggg ccgatgacaa cagaagtgtt
     3001 gactacaatg agaaactgga ttttgaggcc cccccaagca tatggtctag gattgtgagc
     3061 tttggttctg gctggggctt ctgggtatca ccaagcctgt tcataacatc aactcatgta
     3121 atccccacag gcataacaga agcatttgga gtccccatca aacaagttca aatccacaaa
     3181 tcaggtgaat tttgccgatt cagattccca aaaccaatta gaccagatgt gacaggaatg
     3241 atcttggaag aaggtgcgcc tgagggcacc gtggcaactg tgctcatcaa acgccccacc
     3301 ggagagctca tgcctcttgc agccagaatg ggaacacacg caaccatgaa aattcaaggc
     3361 cgcatggttg gcggacagat gggcatgttg ctcactggat caaatgctaa aggaatggat
     3421 ttgggaacaa ctcctggaga ctgtggctgt ccttacatct ataaaagggg caatgactat
     3481 atagtcattg gggtgcacac tgcagcagcc cgtggtggaa acaccgtcat ctgtgccaca
     3541 cagggaagtg agggtgaggc aactcttgag ggtggagatg acaaaggaac atactgtggg
     3601 gcacccatcc taggccctgg gggtgcacca aaattgagca ccaaaaccaa attttggagg
     3661 tcatcgaaca cgccccttcc accagggaca tatgagcctg cctacctcgg cggccgtgac
     3721 ccgcgtgtta agggtgggcc ctccttgcag caggtaatga gagaccagtt gaagccattc
     3781 actgaaccca ggggcaaacc tccaagacca agtgtattgg aagcagccaa acaaaccatc
     3841 atcaatgtcc tcgagcaaac cctggaccct ccacaaaaat ggacatacgc acaggcgtgt
     3901 gcctcacttg acaaaaccac ctccagcggt cacccctatc acgttcgaaa gaatgaattc
     3961 tggaatggtg agaccttcac tggtaaattg gcagaccaag cgtcaaaagc aaacctaatg
     4021 tttgaggaag ggaaacacat gacaccagtg tacacagcag cactcaagga cgagctagtc
     4081 aagactgaga aaatctatgg aaagatcaag aagagactgc tctggggctc tgatttgtcc
     4141 accatgatcc ggtgcgctag gtcatttggt gggctcatgg acgagatgaa ggcacactgt
     4201 atatcactcc cagtccgagt tggcatgaat atgaatgaag atggcccaat aatatttgag
     4261 aaacattcca gatacaaata tcactatgat gcagactact ctcgttggga ttcaacacaa
     4321 cagagggcag tactggcagc agccttggaa atcatggtca gattctctgc agaaccacaa
     4381 ttggcacaaa tagtcgctga ggacctactg gcccctagtg tagtagatgt aggagacttt
     4441 aaaatcacaa taaatgaggg gctcccctct ggtgtgccat gcacttctca atggaactcc
     4501 atcgcacact ggctgctaac tctctgtgcc ttgtctgaag tcactaagct gtcacctgac
     4561 attatacagg caaattccat gttctcattt tacggtgatg acgagattgt cagcaccgac
     4621 ataaagttgg accccgaaca gttaaccgcc aaattgaagg agtacggcct aaaaccaacc
     4681 cgcccagaca aaaccgaggg acccctgatc atcagtgaag atttgaacgg actcactttc
     4741 ctccgaagga cggtgactcg tgacccagct ggctggtttg gaaaactgga ccaaagctca
     4801 attttgaggc agatgtactg gactagagga ccaaatcatg aagaccccaa tgagacaatg
     4861 ataccccatt ctcaaaggcc catacagctc atggcactgc ttggtgaagc ctctcttcac
     4921 ggaccctctt tctacagtaa aatcagtaaa ttggtcataa ctgaactcaa agaaggtggg
     4981 atggactttt acgtgccaag gcaggaaccc atgttcaggt ggatgaggtt ttctgacttg
     5041 agcacgtggg agggcgatcg caatctggct cccaattttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgtt ccatctaatg atggtgcagc cggtctcgta ccagaggtca acaatgagac
     5161 catggcactt gaaccggtgg ctggggcttc gatagccgcc ccactcaccg gtcaaaataa
     5221 tgttatagac ccctggatta gattaaattt tgtgcaggcc cctaatggag agtttacagt
     5281 ctcaccccgc aactcgcctg gggaagtcct actcaatttg gaattaggtc ctgaattgaa
     5341 tccatatttg gcacaccttt ctagaatgta taatggttat gcaggtggag ttgaggtaca
     5401 agtgctactg gctgggaacg cgttcacggc tggaaaattg gtatttgctg cagttccccc
     5461 ccattttcca ttagagaata taagccctgg tcaaataacc atgttccctc atgtaattat
     5521 tgatgttagg actttggaac cagttttatt gcctctacca gatgtcagaa ataacttctt
     5581 ccattacaat cagcaaaatg agccgaggat gaggcttgtt gcaatgcttt atacccctct
     5641 tagatctaat ggttctggtg atgatgtgtt caccgtctcc tgtagggtgc tcactcgacc
     5701 ctctcctgat tttgatttta attatttggt gcccccaaca gttgaatcta aaacaaaacc
     5761 attcacactc cctgtcttga ccattgggga gttaaccaat tccaggttcc ctgtgcccat
     5821 agatgaactc tacactagcc ccaatgagag tttggtggtt caaccccaga acgggaggtg
     5881 cgcgctggat ggggagttgc agggcaccac ccagctcctt cccacggcga tttgctcgtt
     5941 caggggtcgg atcaatcaga aagtgagtgg agagaatcat gtttggaaca tgcaagtcac
     6001 caacattaac ggaacccctt ttgacccaac agaggatgtt ccagcccctc tgggcacgcc
     6061 agatttttct ggcaagctct ttggtgtcct aagccagagg gaccatgata atgcctgcag
     6121 gagtcatgat gcagtgattg caactgattc taccaaattt accccaaaat tgggtgctgt
     6181 acaaattggc acatgggaac aagatgatgt acacatcaac caacccacca agtttactcc
     6241 agttggattg tttgagaatg aaggttttaa tcaatggaca cttcctaatt attctggagc
     6301 tttaacactc aatatggggt tggccccccc tgtggccccc acattccctg gtgagcaaat
     6361 tctcttcttc aggtcccaca ttccccttaa aggaggtgtt gcagacccag ttattgattg
     6421 tcttctaccc caagagtgga tccaacacct ttatcaggag tcagccccct cacaaacaga
     6481 tgtggcactg attagattca caaatccaga cacagggcgt gtcctatttg aagcaaaatt
     6541 gcacaggagt ggctacatca cagtggccaa cactggtagc agaccaattg tggtgccagc
     6601 taatggttat ttcaggtttg actcttgggt taatcagttt tactctcttg cccccatggg
     6661 aactgggaat gggcgcagaa ggatgcagta atggctggag ctttcatagc agggcttgcc
     6721 ggtgacatag tcaccaatag cattggctca ctcgtgaacg ctggggccaa tgcaataaac
     6781 cagaaagtag actttgaaaa caacaagcaa ctacaacagg catcttttaa ccatgacaaa
     6841 gagatgttgc aagctcaaat tcaggccacc aaacagctac aggctgatat gattgcaatc
     6901 agacaagggg tgttgaccgc aggcggcttc tcccctactg atgcagcaag aggtgcagtc
     6961 aacgcgccca tgactcaagt cttggattgg aatgggacca gacattgggc cccaggagcc
     7021 acgaaaacaa ctgctttctc cggtgggttt accagtgcct ctcatgccag gaccgttgac
     7081 ctgaccaaga agacatcagc cacaccagcc cctatgcctg tttctaggcc cagttctatt
     7141 acttccactg tttctactcg ctctactttg attagtgggt cctctaattc tccttcttca
     7201 gctaggagct cttctagtgt ttcttcccaa cctacttcct catcctcccg aactagtgag
     7261 tgggtacgca gtcaaaatag ggcgctggag ccttatatga atggggcgct gcgcacagcc
     7321 tacgtgacgc ctccatccag tagggcttct agcaatggca cagtctcaac cgtgccaaaa
     7381 gaggttttgg actcctggtc gtctgcattc aatacacaca gacagccgct gtttgctcat
     7441 ctccgtcgga gaggggagtc acaagcttag tgaaaagatg gtcttttctt tctttccttt
     7501 gaaa
//