Typing tool

Complete norovirus genomes

MK762560  GII.13
 GII.P16

Length: 7,450 | 3 CDS

ORF1: 1..5097
ORF2: 5078..6706
ORF3: 6706..7437
LOCUS       MK762560                7450 bp    RNA     linear   VRL 13-APR-2019
DEFINITION  Norovirus GII isolate Hu/PR/2014/GII.P16-GII.13/Bayamon0178
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK762560
VERSION     MK762560.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7450)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7450)
  AUTHORS   Barclay,L., Cannon,J.L., Montmayeur,A.M., Tatusov,R.L., Chhabra,P.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7450
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Bayamon0178"
                     /isolate="Hu/PR/2014/GII.P16-GII.13/Bayamon0178"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="Puerto Rico"
                     /collection_date="24-Mar-2014"
                     /note="genotype: GII.P16-GII.13"
     gene            1..5097
                     /gene="ORF1"
     CDS             1..5097
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBX91007.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRIAAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGRVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIVRRMNIQELWSKPPLDQNESEAKEEA
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERVTLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRSDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRVVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..993
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     994..2091
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2092..2622
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2623..3021
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3022..3564
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3565..5094
                     /gene="ORF1"
                     /product="RdRp"
     gene            5078..6706
                     /gene="ORF2"
     CDS             5078..6706
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBX91008.1"
                     /translation="MKMASNDAAPSNDGAASLVPEAINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANSGDNWDQNLLQLTYPSGASYDPTDEVPAPLGTQDFSGILYG
                     VLTQDNVSEGTGEAKNAKGVYISTTSGRFTPKIGTIGLHSITENVHPNQQSRFTPVGV
                     AQNENTPFQQWVLPHYAGALALNTNLAPAVAPTFPGEQLLFFRSRVPCVQGLRGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGTYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6706..7437
                     /gene="ORF3"
     CDS             6706..7437
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBX91009.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIDATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRAQVKSPSNSSQRTAAPSSIRSLSTQSTSLGSTS
                     SEGSSTTSSSSRTADWVQQQRALSPYMQGALQTAYVTPPSSRASSMSSVSTVPKGVLD
                     SWTPVFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaag
       61 gaaaaatctt caggtgaagg cttattcaca aacatgtctt ccaccttaaa gaaagccctc
      121 ggggcccggc ccaaacagcc tgccccgagg gacaactcac aaaagccccc aagaccacca
      181 actcccgagt tggttaagag gataccccct cccccaccta atggagaaga agaagaacca
      241 gtcattaggt atgaggttaa gagtggaatc tctggcctgc ccgagctcac aacagtccct
      301 caaccggatg tggccaacac ggcattcagt gtcccaccgc tgagcttgag agaaaacagg
      361 gaggccaagg aaccgctgac aggggcaata ttagagatgt gggatggaga gatataccac
      421 tatggtctgt acgtggagaa aggcttagtg ttgggtgtgc acaaaccacc tgcagctata
      481 agcatggcaa aagtggagct gacgccgttg tcattgtact ggcgtgtggt ctacaccccc
      541 caatacctca tctcccctga aactctcagg aggctcaacg gagaggcatt cccttacact
      601 gcctttgaca acaactgcta tgccttttgc tgttgggtat tagacctcaa tgactcatgg
      661 cttaacagga ggatggtgca aagaacaaca ggcttcttca gaccttacca agagtggaac
      721 agaaaacccc tgcccactat ggatgactcc aaaatcaaga aggtggcaaa catattcctg
      781 tgttcattgt ccacgttgtt caccagacct ataaaagacc tcataggaaa aattaagcca
      841 ttaaacatct tgaacatcct ggcaacgtgt gactggacat tcgccggaat agtggagtct
      901 ctgatattac ttgctgaact ctttggagtt ttctggacac ccccagatgt gtctgctatg
      961 atcgctcctt tacttggaga ctacgagttg caagggccag aagaccttgc cgttgagctc
     1021 gtacctgtag taatgggagg gattggtttg gtgttgggat tcaccaaaga gaaaattgga
     1081 aaaatgttgt cctcagcagc atcaacgctc agggcttgta aagatcttgg tgcctatggc
     1141 ttagagatac tcaaattggt catgaagtgg ttcttcccaa agaaagaaga ggccaatgag
     1201 ctagccatgg tgagagctat agaggatgct gtactggatc ttgaggcaat agaaaataat
     1261 cacatgacaa ctctgttgaa agacaaagac agcctagcaa cctacatgaa aacactagac
     1321 atggaggagg aaaaagccag aagattgtcc acaaaatctg catcccctga catagttggg
     1381 acgatcaacg ccctgctggc tcgaatagca gcggctaggt cactagtcca cagggccaag
     1441 gaggagttat ctagcaggat aagaccagtg gttgttatga tatctggcaa accagggata
     1501 ggcaaaactc atttggccag ggaggtggca agaaaggtgg catccactct cacaggggat
     1561 caaagagtcg ggctcatacc gagaaacggt gtggaccatt gggatgcata caaaggtgag
     1621 agagtcgtgc tgtgggacga ctatggcatg agcaacccca ttcatgatgc tctgcgcata
     1681 caagaattgg ctgatacgtg tccccttacc ttaaattgtg acagaattga aaataaggga
     1741 aaagtttttg acagtgaagt cataataatc acaacaaacc ttgccaatcc agctccactt
     1801 gattatgtca actttgaggc ctgttccagg agaattgact tcctggtgta cgccgaggca
     1861 ccagaagtag aaaaggcgaa acgagacttt cctggtcaac cagatatgtg gaaggacgcc
     1921 ttcaagtcgg acttttcaca tatcaagttg caacttgcac ctcagggcgg ctttgacaag
     1981 aatggcaaca ccccacatgg gaaaggagtg atgaagaccc tcaccaccgg ttccctgatc
     2041 gcccgtgcat caggcttact gcatgagagg atggatgaat ttgaactcca aggccccaca
     2101 gtcaccacct tcaattttga ccggaacaga atcgctgcat tcagacaatt ggctgcagaa
     2161 aacaagtatg gattggtgga caccatgaga gttggcaatc aattaaaagg ggtgaaaacc
     2221 atggaagaac tcaaacaagc aatcaagaat gtgatcatca agaggtgccg gatcatctac
     2281 ggcggctcca cgtatgacct tgaatctgat ggcaagggca gagttctggt ggaaaaggtc
     2341 aagaacacct ctgtacagac caacaacgag ttggccggag ccctgcatca cctcaaacat
     2401 gcccgaatca ggtactatgt caaatgtgtg caagaagcag tctactctat tatacaaatc
     2461 gccggcgctg cgtttgtcac cacacgcata gtacgccgca tgaacataca agagctttgg
     2521 tcgaagccac cattagacca aaatgaatca gaggctaagg aagaggcccc caagtcagaa
     2581 gatgacgagt tcatcatatc ttctaaggac atcaaggagg aaggaaagaa gggcaaaaac
     2641 aaaactggcc gtggcaagaa acatactgca ttctctagca agggcttgag cgatgaggag
     2701 tatgacgagt acaagaggat aagagaagag agaaatggga agtactctat agaggagtat
     2761 cttcaagaca gagacaggta ctatgaggaa ctcgccatcg ccaaggccac ggaagaagac
     2821 ttctgtgagg aggaggagat caaaatccgt cagaggatct tccgtcccac caggaagcaa
     2881 aggaaggaag agagggtcac actagggcta gtaactggtt cagaaatcag aaaaagaaac
     2941 cctgatgact tcaaacctaa agggaaactg tgggctgatg acaacagaag tgttgattac
     3001 aatgagaaac tggactttga ggccccccca agcatatggt ctaggattgt gagttttggt
     3061 tctggttggg gcttctgggt gtcaccaagc ctgttcataa catcaactca cgtaatccct
     3121 gcaggcataa cagaggcatt tggagtcccc atcaaacaaa tccaggtcca caaatcaggt
     3181 gaattttgtc ggttcagatt cccaaaacca attagatcag atgtgacagg aatgatcttg
     3241 gaagaaggtg cgcctgaggg caccgtggca accgtgctca tcaaacgccc taccggagag
     3301 ctcatgcccc ttgcagccag aatgggaaca cacgcaacca tgaaaattca gggccgcatg
     3361 gttggcgggc agatgggtat gttgctcact ggttcaaatg ctaaaggaat ggatttggga
     3421 acaactcctg gtgattgtgg ctgtccctac atctacaaaa ggggcaatga ctatatagtc
     3481 attggggtgc acacagcagc agcccgtggt ggaaacaccg tcatctgtgc cacacaggga
     3541 agtgagggtg aggcaactct tgagggtgga gatgacaaag gaacatactg tggggcaccc
     3601 attctaggcc ctgggggggc accaaaattg agcaccaaaa ccaaattttg gaggtcatcg
     3661 aacacgcctc ttccaccagg gacgtatgag cctgcctacc tcggtggccg tgacccgcgt
     3721 gttaagggtg ggccctcctt gcagcaggta atgagagatc agttgaagcc attcaccgag
     3781 cccaggggta aacctccaag accaagtgtg ttggaagcag ctaaacaaac catcatcaat
     3841 gtcctcgaac aaaccctgga ccctccacaa aaatggacat acgcacaggc gtgtgcttca
     3901 cttgacaaaa ccacctccag cgggcatccc caccacgtcc gaaagaatga attctggaat
     3961 ggtgagacct tcactggtaa attggcagac caagcatcaa aagcaaatct aatgtttgag
     4021 gaagggaaac acatgacacc agtgtataca gcagccctca aggatgagct ggtcaagact
     4081 gacaaagtct atggaaagat caagaagaga ctgctctggg gctctgactt gtccaccatg
     4141 atccggtgcg ccaggtcctt tggtgggctc atggatgaga tgaaagcaca ctgcatatca
     4201 ctcccagtcc gagttggcat gaacatgaat gaagatggtc caataatatt tgagaagcac
     4261 tccagatata agtatcacta tgatgcagat tactcccgct gggattcaac acaacagagg
     4321 gtagtactag cagcagcctt ggagatcatg gtcaggttct ctgcagagcc acaattggca
     4381 caaatagtcg ctgaggatct gctggccccc agtgtggtag atgtaggaga ctttaaaatt
     4441 tcaataaatg aagggctccc ctctggtgta ccatgcactt ctcaatggaa ttccatcgca
     4501 cactggctgc taaccctctg cgccttgtct gaagtcacca aactgtcccc tgacattgta
     4561 caggcaaatt ccatgttctc attttacggt gatgacgaga ttgtcagcac cgatataaaa
     4621 ttggaccctg aaaagttaac caccaaattg aaggagtacg gcctgaaacc aactcgccca
     4681 gacaaaaccg agggacccct gatcatcagt gaggatttga acggactcac tttcctccgg
     4741 aggacggtga ctcgtgaccc agctggctgg tttggaaaat tggaccaaag ctcaatattg
     4801 aggcagatgt actggactag aggaccaaat catgaagacc ccaatgagac aatgataccc
     4861 cactctcaaa gacccataca gctcatggca ctgcttggtg aggcctccct tcacggaccc
     4921 tctttctaca gcaaaattag taagttggtc ataactgaac tcaaagaagg tgggatggac
     4981 ttttacgtgc caaggcagga acccatgttc aggtggatga ggttttctga cttgagcacg
     5041 tgggagggcg atcgcaatct ggctcccaat tttgtgaatg aagatggcgt cgaatgacgc
     5101 cgctccatcg aatgatggtg cagctagtct cgtaccagag gccattaatg agactatgcc
     5161 attggaaccc gttgctggcg catctattgc tgccccagtg gcgggacaaa ctaacataat
     5221 tgacccctgg ataagaacaa attttgtgca agcccctaat ggagagttta cagtatcacc
     5281 gagaaattcc cctggagaga ttctattaaa tttagagttg ggaccagatt tgaatcctta
     5341 tttggcccat ctatcaagga tgtacaatgg atacgctgga ggtgttgagg tgcaagtgct
     5401 tcttgctggg aacgcgttca cagcaggaaa gatattattt gcagcaatcc cacccaactt
     5461 tcctgtagat atgatcagcc cagctcaaat tactatgctt ccccatttga ttgtagatgt
     5521 taggacattg gaacctatta tgataccctt acctgatgtt aggaatgtgt tctatcattt
     5581 taataatcaa ccccaaccta ggatgagatt agtggctatg ctctataccc cattgagatc
     5641 taatggttca ggagatgatg tctttactgt gtcttgtaga gtgttgacta ggccaacccc
     5701 tgactttgaa ttcatttacc tagtgcctcc ctctgtagag tccaaaacta aaccattcac
     5761 acttccaata ttgaccattt ctgaactaac caactcccgg tttcccatcc caattgagca
     5821 actgtacacg gccccaaatg agaataatgt tgtgcagtgt caaaatggaa ggtgcacctt
     5881 ggatggagag cttcagggca ccacccagct gctatcaagt gcagtttgct cgtacagggg
     5941 caggactgtg gctaacagtg gggacaattg ggaccagaat ttgctccagc tgacctaccc
     6001 aagcggtgca agctatgacc ccactgatga agtaccagca cccttgggca cccaggattt
     6061 cagtgggata ttgtatgggg tgttaaccca agacaatgta agtgagggta caggggaggc
     6121 caaaaatgct aagggagtat acatatccac caccagtgga agattcaccc caaaaattgg
     6181 gacaattgga ttgcattcaa taactgaaaa tgtgcacccc aatcagcaat cacggttcac
     6241 ccccgttgga gtcgctcaga atgaaaacac ccccttccag caatgggttc taccacacta
     6301 cgcaggtgct ctcgctctaa ataccaattt ggcacccgct gttgccccga ctttccctgg
     6361 cgagcaatta ctgttcttca ggtcccgtgt tccatgtgtt caaggtctgc gggggcagga
     6421 tgctttcata gattgtctcc tacctcaaga gtgggtgaac catttttatc aagaggctgc
     6481 tccctcccaa gcagacgttg ccctcatcag gtatgtcaac cctgatactg gtcgcacgtt
     6541 gtttgaggcc aaattgcaca ggtcaggttt cattactgta tcacacactg gtacctaccc
     6601 tcttgtggtc cccccaaatg gtcatttcag gtttgactct tgggttaacc aattctactc
     6661 actcgccccc atgggaactg gcaatgggcg tagaagagtt caataatggc aggagcattc
     6721 atagctggtc tagccggtga catgctgact tctgctgttg gttcactgac ctctgcagga
     6781 gccaatgcca tcaatcagaa attgaatttt gattacaata aacaactcca aaatgcatcc
     6841 tttcaacatg ataaggaaat gttgcaggcc caaattgatg ctacaaagaa gctccaatca
     6901 gaaatgattg caattaagca tggggttctg accgcgggcg gcttttcccc agctgatgca
     6961 gccagagggg cagtcaacgc cccaatgact cgagtgttgg attggtcagg gacacgctac
     7021 tacgctccaa attctgtgca aaccaccagt tattctgggc aattcacccc ctcgcctgtc
     7081 catcgggcgc aggtgaagtc cccttccaat tcatctcagc ggactgcagc tccaagcagt
     7141 atccgcagcc tgtcaaccca atcaacttct ttaggctcca cctcctcaga ggggtcctct
     7201 acaacctcct ctagttcgag gacagcagac tgggtgcaac aacaaagggc tcttagcccg
     7261 tacatgcagg gagccctgca gacggcatac gtcacaccgc cgtctagtag ggcttccagt
     7321 atgagctctg tctcaacagt gcccaaaggg gttttggact cctggacgcc tgtgtttaac
     7381 acacgcaggc agccgctgtt tgcacacctc aggaagaggg gggagtcaca ggcttagtga
     7441 aaaggataat
//