Typing tool

Complete norovirus genomes

MK754445  GII.12
 GII.P16

Length: 7,513 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6688
ORF3: 6688..7467
LOCUS       MK754445                7513 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.12/Somerset0204
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK754445
VERSION     MK754445.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7513)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7513)
  AUTHORS   Barclay,L., Cannon,J.L., Johnston,J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7513
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Somerset0204"
                     /isolate="Hu/US/2017/GII.P16-GII.12/Somerset0204"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="11-Dec-2017"
                     /note="genotype: GII.P16-GII.12"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBW96036.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPLTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLV
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDV
                     EKAKRDFPGQPDMWKDAFKTDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVNNASVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKPEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPTGITEAFGVPIKQVQIHKSGEFCRFRFPKPIRQDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLDQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPDETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6688
                     /gene="ORF2"
     CDS             5081..6688
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBW96037.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVLAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPVLTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATDSTKFTPKLGAVQIGTWEQDDVHINQPTKFTPVGLFEN
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6688..7467
                     /gene="ORF3"
     CDS             6688..7467
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBW96038.1"
                     /translation="MAGAFIAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQVQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGATKTTAFSGGFTSASHARTVDLTKKTSATPAPMPVSRPSSIASTVSTRSTL
                     ISGSSNSPSSARSSSSVSSQPTSSSSRTSEWVRSQNRALEPYMNGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWSSAFNTHRQPLFAHLRRRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaag
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacta
      181 actcccgagt tggtcaaaag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaagcca aggaaccgct aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactacggcc tgtacgtgga gaaaggctta gtgttgggtg tacacaaacc acctgcagcc
      481 ataagcatgg caaaagtgga gctgacgccg ctgtcattgt attggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaactctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tattagacct caatgactca
      661 tggcttagca ggaggatggt gcaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt gttcactaga cccataaaag acctcgtagg aaaaattaaa
      841 ccattaaata tattgaatat cctggcaacg tgtgactgga cgtttgccgg aatagtggag
      901 tctctaatat tacttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttacttgg ggattacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtgatggg agggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagacct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcca tggtgagggc catagaggac gctgtactag atcttgaggc aatagaaaac
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc cagaaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaggaagagc tatctagcag gatgagacca gtagttgtta tgatatctgg caaaccagga
     1501 ataggcaaaa cccatctggc cagggaagtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accaagaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagcaacc ccattcatga tgctcttcgc
     1681 atacaagaat tggctgatac gtgtcccctc accttaaatt gtgacagaat tgaaaataaa
     1741 ggaaaagttt ttgacagtga agtcataata atcacaacaa accttgccaa tccagccccg
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg atttcctggt gtacgctgag
     1861 gcaccagatg tagaaaaggc aaaacgggac tttcctggtc agccagatat gtggaaggac
     1921 gccttcaaaa cggacttttc acacatcaag ctacagcttg caccccaggg cggctttgac
     1981 aaaaacggca acaccccaca tgggaaaggg gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgcg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtcct
     2101 acaatcacca ccttcaattt cgaccggaat agaatcacag cattcagaca attggctgca
     2161 gaaaacaagt atggactggt ggacaccatg aaagtcggca atcaattaaa aggagtgaaa
     2221 accatggaag agctcaaaca agcaatcagg aatgtgacca tcaagaggtg ccggatcatc
     2281 tacggtggtt ccacatatga ccttgaatct gatggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaataacg cctctgtaca gaccaacaac gagttggccg gggccctgca ccatctcaaa
     2401 cacgcccgaa tcaggtacta tgtcaagtgt gtgcaagaag cagtctattc tatcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaattgga tcaaaatgaa tcagagacta aggaagaggc ccccaagcca
     2581 gaagatgacg agttcgtcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aataaaactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggaa
     2761 tatcttcaag acagagacag gtactatgaa gaactcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga gataaaaatc cgtcagagaa ttttccgtcc taccaggaaa
     2881 caaaggaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaagaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag aagtgttgac
     3001 tacaatgaga aactggattt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtatcacca agcctgttta taacatcaac tcatgtaatc
     3121 cccacaggca taacagaagc atttggagtc cccatcaaac aagtccaaat ccacaaatca
     3181 ggtgaatttt gccgattcag attcccaaaa ccaattagac aagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg catgttgctc actggatcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggagactg tggctgtcct tacatctata aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccatcctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggcgg ccgtgacccg
     3721 cgtgttaagg gtgggccctc cttgcagcag gtaatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtattggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg atcaaaccct ggaccctcca caaaaatgga cctacgcaca ggcgtgtgcc
     3901 tcacttgaca aaaccacctc cagcggtcac ccctatcacg ttcgaaagaa tgaattctgg
     3961 aatggtgaaa ccttcactgg taaattggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtat acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga tttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg ctcatggacg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatatca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtac tggcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga cctactggcc cctagtgtag tagatgtagg agactttaaa
     4441 atcacaataa atgaggggct cccctctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ctaagctgtc acctgacatt
     4561 atacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ccgaacagtt aaccgccaag ttgaaggagt acggcctaaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgatcatc agtgaagatt tgaacggact cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccgatga gacaatgata
     4861 ccccattctc aaaggcccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctaatgatg gtgcagccgg tctcgtacca gaggtcaaca atgagaccat
     5161 ggcacttgaa ccggtggctg gggcttcgat agccgcccca ctcaccggcc aaaataatgt
     5221 tatagacccc tggattagat taaattttgt gcaggcccct aatggagagt ttacagtctc
     5281 accccgcaac tcgcctgggg aagtcctact caatttggaa ttaggtcccg aattgaatcc
     5341 atatttggca cacctttcta gaatgtataa tggttatgca ggtggagttg aggtacaagt
     5401 gctactggcc gggaacgcgt tcacggctgg aaaattggta cttgctgcag ttccccctca
     5461 ttttccatta gagaatataa gccctggtca aataaccatg ttccctcatg taattattga
     5521 tgttaggact ttggaaccag ttttattgcc tctaccagat gtcagaaata acttcttcca
     5581 ttacaatcag caaaatgagc cgaggatgag gcttgttgca atgctttata cccctcttag
     5641 atctaatggt tctggtgatg atgtgttcac cgtctcctgt agggtgctca ctcgaccctc
     5701 tcctgatttt gattttaatt atttggtgcc cccaacagtc gaatctaaaa caaaaccatt
     5761 cacactccct gtcttgacca ttggggagtt aaccaattcc aggttccctg tgcccataga
     5821 tgaactctac actagcccca atgagagttt ggtggtacaa ccccagaacg ggaggtgcgc
     5881 gctggatggg gagttgcagg gcaccaccca gctccttccc acggcgattt gctcgttcag
     5941 gggtcggatc aatcagaaag tgagtggaga gaatcatgtt tggaacatgc aagtcaccaa
     6001 cattaacgga accccttttg atccaacaga ggatgttcca gcccctctgg gcacgccaga
     6061 cttttctggc aagctctttg gtgtcctaag ccagagggac catgataatg cctgcaggag
     6121 tcatgatgca gtgattgcaa ctgattctac caaatttacc ccaaaattgg gtgctgtaca
     6181 aattggcaca tgggaacaag atgatgtaca catcaaccaa cccaccaagt ttactccagt
     6241 tggattgttt gagaatgaag gttttaatca atggacactt cctaattatt ctggagcttt
     6301 aacactcaat atggggttgg ccccccctgt ggcccccaca ttccctggtg agcaaattct
     6361 cttcttcagg tcccacattc cccttaaagg aggtgttgca gacccagtta ttgattgtct
     6421 tctaccccaa gagtggatcc aacaccttta tcaggagtca gccccttcac aaacagatgt
     6481 ggcactgatt agattcacaa atccagacac agggcgtgtc ctatttgaag caaaattgca
     6541 caggagtggc tacatcacag tggccaacac tggtagcaga ccaattgtgg tgccagctaa
     6601 tggttatttc aggtttgact cttgggttaa tcagttttac tctcttgccc ccatgggaac
     6661 tgggaatggg cgcagaagga tgcagtaatg gctggagctt tcatagcagg gcttgccggt
     6721 gacatagtca ccaatagcat tggctcactc gtgaacgctg gggccaatgc aataaaccag
     6781 aaagtagact ttgaaaacaa caagcaacta caacaagcat ctttcaacca tgacaaagag
     6841 atgttgcaag ttcaaattca ggccaccaaa cagctacagg ctgatatgat tgcaatcaga
     6901 caaggggtgt tgaccgcagg cggcttctcc cctactgatg cagcaagagg tgcagtcaac
     6961 gcgcccatga ctcaagtctt ggattggaat gggaccagac attgggcccc cggagccacg
     7021 aaaacaactg ctttctccgg tgggtttacc agtgcctctc atgccaggac cgttgacctg
     7081 accaagaaga catcagccac accagcccct atgcctgttt ctaggcccag ttctattgct
     7141 tccactgttt ctactcgctc tactttgatt agtgggtctt ctaattctcc ttcttcagct
     7201 aggagctctt ctagtgtttc ttcccaaccc acttcctcat cctcccgaac tagtgagtgg
     7261 gtacgcagtc aaaatagggc gctggagcct tatatgaatg gggcgctgcg tacagcctac
     7321 gtgacgcctc catccagtag ggcttctagc aatggcacag tctcaaccgt gccaaaagag
     7381 gttttggact cctggtcgtc tgcgttcaat acacacagac agccgctgtt tgctcatctc
     7441 cgtcggagag gggagtcaca agcttagtga aaagatggtc ttttctttct ttcctttgaa
     7501 aatccctgtc gac
//