Typing tool

Complete norovirus genomes

MK753034  GII.1
 GII.P16

Length: 7,494 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7465
LOCUS       MK753034                7494 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.1/SaltLake0124
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753034
VERSION     MK753034.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7494)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7494)
  AUTHORS   Barclay,L., Cannon,J.L., Pan,C.-Y., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7494
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="SaltLake0124"
                     /isolate="Hu/US/2017/GII.P16-GII.1/SaltLake0124"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="18-Jun-2017"
                     /note="genotype: GII.P16-GII.1"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS54672.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PGVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGLFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKPEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQVQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6692
                     /gene="ORF2"
     CDS             5085..6692
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS54673.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPFLAHLSRMYNGYAGG
                     VDVQVLLAGNAFTAGKLVFAAIPPHFPLENLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQPEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVVVQPQNGRSTLDGELLGTT
                     QLVPSNICALRGRINAQVPDDHHQWNLQVTNANGTPFDPTEDVPAPLGTPDFLANIYG
                     VTSQRNPDNTCRAHDGVLATWSPKFTPKLGSVVLGTWEERDLDLNQPTRFTPVGLYDT
                     NHFDQWILPNYSGRLTLNMNLAPSVAPLFPGEQILFFRSHIPLKGGTSNGAIDCLLPQ
                     EWVQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6692..7465
                     /gene="ORF3"
     CDS             6692..7465
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS54674.1"
                     /translation="MAGAFVAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMVALRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRYWAPGATKTTAFSGGFTSSPNTRTVDLPRKTSTTPAPTPISRSSSSASTVSTRSTI
                     VSGTSGLSSLTRSSFNSQPTSSSSRTSEWVRSQNRALEPYMRGALQTAYVTPPSSRAS
                     SNGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRRRGESHV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacgaa ccacaaaagc ccccaagacc
      181 accaactcca gagttggtca agaggatacc ccctcctcca cctaatggcg aggaagaaga
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccgggcgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaagaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agctataagc atggcaagag tggagttgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcgttccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaaccccttc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaagat
      841 taaaccatta aacatattga acatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggacttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgaattgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggaggaat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgcaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagtta gccatggtga gggccataga ggatgccgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gctgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctgtcta gcaggatgag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg atgcgtacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagc aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg acacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 taagggaaaa gtttttgaca gtgaggtcat aataatcaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcttg ttccaggaga attgattttc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggactttcct ggtcagccag acatgtggaa
     1921 ggacgccttc aagccggact tctcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa gggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgcgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcccacaatc accaccttca atttcgaccg taacagaatc acagcattca gacaattggc
     2161 tgcggaaaac aagtatggat tggtggatac catgaaagtt ggcaatcaac taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtt accatcaaga ggtgccggat
     2281 catctacggt ggctccacgt atgaccttga atctgatggc aagggtaaag ttttggtgga
     2341 aaaggtcaag aacacatctg tacagaccaa caacgagctg gctggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attccatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga atatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag actaaggagg aggcccccaa
     2581 gccagaagat gacgagttca tcatatcctc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaag actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgcgaagagg aggagatcaa aattcgtcag agaattttcc gtcccaccag
     2881 gaagcaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaagctgg actttgaggc ccctccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtgtc accaagtctg ttcataacat caactcatgt
     3121 aatccccgca ggcataacag aagcgtttgg agtccccatc aaacaagttc agattcataa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg tgacagggat
     3241 gatcttagaa gagggtgcgc ctgaaggcac cgtagcaact gtgcttatca aacgccccac
     3301 cggagagctt atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaggg
     3361 tcgcatggtc ggcggacaga tgggtatgtt gctcactgga tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggtg actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgcggtgga aacactgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 agcacctatt ctaggccctg ggggtgcacc aaagttgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccagggac atatgaacct gcctacctcg gtggccgtga
     3721 tccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaagc ctccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 catcaacgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcatcactt gataaaacca cctccagcgg gcacccccat cacgtccgga agaatgaatt
     3961 ctggaatggt gagaccttca ctggcaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggaa gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtacgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatataaat atcactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtgctagcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg tgggagactt
     4441 taaaatcaca ataaatgaag ggctcccatc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgtgc cttgtctgaa gtcaccaaac tatcccctga
     4561 cattatacaa gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccctgaac agttaaccgc caaattgaag gagtacggcc tgaaaccaac
     4681 tcgcccagac aagaccgagg gacccctgat tatcagtgaa gatttgaacg gactcacttt
     4741 cctccggagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tctcaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggttata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaagaacc catgttcaga tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgcag ccggtctcgt accagaggtc aacaacgaga
     5161 cgatggcact tgagccggtg gctggggctt ctatagctgc ccctttaacc ggccaaaata
     5221 atgtgataga cccctggatt agaatgaatt ttgtccaagc tccaaatggt gaatttacag
     5281 tgtccccccg taattcccca ggtgaagtgt tgttgaattt ggaattaggt cctgaactaa
     5341 atccattcct ggcacacctt tcaagaatgt ataatggtta tgctggtggg gttgatgtgc
     5401 aggtgctgct tgctgggaat gcgttcacag cgggaaaact agtgtttgca gcaatccccc
     5461 cacatttccc tcttgagaat ttgagtcctg gtcaaattac aatgttccct catgtgatta
     5521 ttgatgttag aactttagaa cctgtccttt tgcctttacc agatgttaga aataatttct
     5581 ttcattacaa tcagcagcct gagccccgta tgagacttgt ggctatgttg tatactcctc
     5641 tcagatctaa tggctctggt gatgatgtgt tcacagtctc ttgtagggtt ctcactcgcc
     5701 cctctccaga ctttgatttc aattacttgg ttcccccaac tgtggaatct aaaaccaaac
     5761 catttaccct gccaatattg accattggag aattgtcaaa ttctaggttc ccagtgccaa
     5821 tagatgaatt gtatacaagc cctaatgaag gagtggttgt gcaacctcaa aatggcagat
     5881 caacacttga tggtgaactg cttggcacca cacaacttgt accatcaaac atctgcgcct
     5941 tgcgagggcg catcaacgcc caagtgccag acgaccacca tcaatggaac ttgcaggtta
     6001 caaacgcaaa tgggaccccc ttcgacccca ctgaagatgt ccctgcacca ttgggcacgc
     6061 cggatttctt ggcaaacatc tacggagtta ctagccagag gaatcctgac aacacttgcc
     6121 gtgcccacga tggggtcttg gcaacctgga gccctaagtt cacacccaag ttaggctctg
     6181 tggttttggg tacttgggaa gaacgtgatc ttgatctcaa tcaacctacc agattcacac
     6241 ctgttggtct gtatgacaca aaccactttg atcagtggat tctacccaac tactctggaa
     6301 gattgacctt aaacatgaat ttggcgccct ccgttgctcc ccttttccca ggtgaacaaa
     6361 tactcttctt taggtcccac ataccactca aaggaggcac ttccaacggt gccattgact
     6421 gtctactccc ccaggagtgg gtccagcatt tctatcagga atcagccccg tcacccacag
     6481 atgttgctct gattaggtac accaaccctg acacgggccg tgtccttttt gaggccaaac
     6541 tacatagaca gggattcatc acagtagcaa attctggttc tagacctatt gttgtccccc
     6601 ctaatggtta ttttaggttt gattcttggg ttaatcagtt ttactctctc gcccccatgg
     6661 gaactgggaa tgggcgtaga agagtgcagt aatggctgga gcttttgtag caggtcttgc
     6721 cggtgatata gtcaccaata gcattggttc acttgtgaac gctggagcca atgcaataaa
     6781 ccaaaaagta gattttgaaa acaacaaaca actacagcag gcctctttca accatgacaa
     6841 ggaaatgttg caagctcaaa ttcaggccac aaaacaatta caggctgaca tggttgcgct
     6901 cagacaaggg gtgttgaccg caggcggctt ctcccctact gatgcagcaa gaggggcggt
     6961 taatgcgccc atgacgcaag tcttggactg gaatgggact aggtactggg cccccggagc
     7021 caccaaaaca actgctttct ccggtgggtt cacaagctct cccaacacca ggactgttga
     7081 tttgcctagg aaaacatcaa ctacaccagc ccccacacct atatctagat ctagttcttc
     7141 tgcttctact gtttctaccc gctcaacaat tgtcagcggg acttctggcc tttcttcttt
     7201 gactaggagc tcttttaatt cccagcccac ctcctcttct tctcggacta gcgagtgggt
     7261 gcgtagtcaa aacagggcgc tggagcccta catgagggga gcactgcaaa ctgcttacgt
     7321 gacgcctccc tctagtagag catccagcaa tggcacagtc tcaaccgtgc caaaagaagt
     7381 tttggactcc tggacatctg cgttcaacac ccacagacaa ccgcttttcg ctcatctccg
     7441 tcggagaggg gagtcacatg tttagtgaaa agatgatttt tcttccactc ttct
//