Typing tool

Complete norovirus genomes

MK753033  GII.1
 GII.P16

Length: 7,486 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6688
ORF3: 6688..7461
LOCUS       MK753033                7486 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P16-GII.1/Maricopa0357
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753033
VERSION     MK753033.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7486)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7486)
  AUTHORS   Barclay,L., Cannon,J.L., Pan,C.-Y., Montmayeur,A.M., Tatusov,R.L.,
            Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7486
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Maricopa0357"
                     /isolate="Hu/US/2016/GII.P16-GII.1/Maricopa0357"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="11-Nov-2016"
                     /note="genotype: GII.P16-GII.1"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS54669.1"
                     /translation="MKKASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PGVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKILVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKPEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYNEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQVQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTIICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAVALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6688
                     /gene="ORF2"
     CDS             5081..6688
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS54670.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPFLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPLENLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQPEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELSNSRFPVPIDELYTSPNEGVVVQPQNGRSTLDGELLGTT
                     QLVPSNICALRGRINAQVPDDHHQWNLQVTNANGTPFDPTEDVPAPLGTPDFLANIYG
                     VTSQRNPDNTCRAHDGVLATWSPKFTPKLGSVVLGTWEEHDLDLNQPTRFTPVGLYDT
                     NHFDQWILPNYSGRLTLNMNLAPSVAPLFPGEQILFFRSHIPLKGGTSNGAIDCLLPQ
                     EWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6688..7461
                     /gene="ORF3"
     CDS             6688..7461
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS54671.1"
                     /translation="MAGAFVAGLAGDIVTNSIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIALRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRYWAPGATKTTAFSGGFTSSPNTRTVDLPRKTSTTPAPTPISRSSSSASTVSTRSTI
                     VSGTSGLSSLTRSSFNSQPTSSSSRTSEWVRSQNRALEPYMRGALQTAYVTPPSSRAS
                     SNGTVSTVPKEVLDSWTSVFNTHRQPLFAHLRRRGESQA"
ORIGIN      
        1 atgaagaagg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaag
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacgaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cctccaccta atggcgagga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg gcgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaggcca aagaaccgct aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gttgacgccg ctgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaactctc aggaggctca acggagaggc gttcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt gcaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatca agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt attcaccaga cccataaaag acctcatagg aaagattaaa
      841 ccattaaaca tattgaacat cctggcaacg tgtgactgga cgtttgccgg aatagtggag
      901 tctctgatat tacttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgaa ctgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg agggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagttagcca tggtgagggc catagaggat gccgtactag atcttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc cagaaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaggaagagc tgtctagcag gataagacca gtagttgtta tgatatctgg caaaccagga
     1501 ataggcaaaa ctcatctggc cagggaggtg gcaagaaaag tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accaagaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagcaacc ccattcatga tgctcttcgc
     1681 atacaagaat tggctgacac gtgtcccctt accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagttt ttgacagtga ggtcataata atcacaacaa accttgccaa cccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg attttctggt gtacgctgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc agccagacat gtggaaggac
     1921 gccttcaagc cggacttctc acacatcaag ctacagcttg cacctcaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaggga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgcg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacag cattcagaca attggctgcg
     2161 gaaaacaagt atggattggt ggataccatg aaagttggca atcaactaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccggatcatc
     2281 tacggtggct ccacgtatga ccttgaatct gatggcaagg gcaaaatttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaacaac gagctggctg gggccctgca ccatctcaaa
     2401 cacgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctattc catcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaattaga tcaaaatgaa tcagagacta aggaagaggc ccccaagcca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaagactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtataacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgcg aagaggagga gatcaaaatc cgtcagagaa ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag aagtgttgac
     3001 tacaatgaga agctggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttccggtt ggggcttctg ggtatcacca agcctgttca taacatcaac tcatgtaatc
     3121 cccgcaggca taacagaagc gtttggagtc cccatcaaac aagttcagat tcacaaatca
     3181 ggtgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatc
     3241 ttagaagagg gtgcgcctga aggcaccgta gcaactgtgc ttatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggatcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggtgactg tggctgtcct tacatctata aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ctatcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggagca
     3601 cctattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggtgg ccgtgatccg
     3721 cgtgttaagg gtgggccctc cttgcagcag gtaatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaagcctcc aagaccaagt gtattggaag ctgccaaaca aaccattatc
     3841 aacgtcctcg aacaaacctt ggaccctcca caaaaatgga catacgcgca ggcgtgtgca
     3901 tcacttgaca aaaccacctc cagcgggcat ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg caaattggca gaccaagcat caaaagcaaa ccttatgttt
     4021 gaggaaggga aacacatgac accagtgtat acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg ctcatggacg agatgaaggc acactgcata
     4201 tcactcccag tacgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatacca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtgc tagcagtagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga tctgctggcc cctagtgtag tagatgtggg agactttaaa
     4441 atcacaataa atgaagggct cccatctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgacatt
     4561 atacaagcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctgaa accaacccgc
     4681 ccagacaaga ccgagggacc cctgattatc agtgaagatt tgaacggact cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gttataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcagatgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctaatgatg gtgcagccgg tctcgtacca gaggtcaaca acgagacgat
     5161 ggcacttgag ccggtggctg gggcttctat agctgcccct ttaaccggcc aaaataatgt
     5221 gatagacccc tggattagaa tgaattttgt ccaagctcca aatggtgaat ttacagtgtc
     5281 cccccgtaat tccccaggtg aagtgttgtt gaatttggaa ttaggtcctg aactaaatcc
     5341 attcctggca cacctttcaa gaatgtataa tggttatgct ggtggggttg aagtgcaggt
     5401 gctacttgct gggaatgcgt tcacagcagg aaaactagtg tttgcagcaa tccccccaca
     5461 tttccctctt gagaatttga gtcctggtca aattacaatg ttccctcatg tgattattga
     5521 tgttagaact ttagaacctg tccttttgcc tttaccagat gttagaaata atttcttcca
     5581 ttacaatcag cagcctgagc cccgtatgag acttgtggct atgttgtata ctcctctcag
     5641 atctaatggc tctggtgatg atgtgttcac agtctcttgt agggtcctca cccgtccctc
     5701 tccagacttt gattttaatt acttggttcc cccaactgtg gaatctaaaa ccaaaccatt
     5761 taccctgcca atattaacca ttggagaatt gtcaaattct aggttcccag tgccaataga
     5821 tgaattgtat accagtccca atgaaggagt ggttgtgcaa cctcaaaatg gcagatcaac
     5881 acttgatggt gaactgcttg gcaccacaca acttgtacca tcaaacatct gcgccttgcg
     5941 agggcgcatc aacgcccaag tgccagacga ccaccatcaa tggaacttgc aggttacaaa
     6001 cgcaaatggg actcccttcg accccactga agatgtccct gcaccattgg gcacgccgga
     6061 tttcttggca aacatctacg gagttactag ccagaggaat cctgacaaca cttgccgtgc
     6121 ccatgatggg gtcttggcaa cctggagccc taaattcaca cccaagttag gctctgtggt
     6181 tttgggtact tgggaagaac atgatcttga tcttaaccaa cccaccagat tcacacctgt
     6241 tggtctgtat gatacaaacc actttgatca gtggattcta cccaactact ctggaagatt
     6301 gaccttaaat atgaatttgg cgccctccgt tgctcccctt ttcccaggtg aacaaatact
     6361 cttctttagg tcccacatac cacttaaagg aggcacttcc aacggtgcca ttgactgtct
     6421 actccctcag gagtggatcc agcatttcta tcaggaatca gccccgtcac ccacagatgt
     6481 tgctctgatt aggtacacca accctgacac gggccgtgtc ctttttgagg ccaaactaca
     6541 tagacaggga ttcatcacag tagcaaattc tggttctaga cctattgttg tcccccctaa
     6601 tggttatttt aggtttgatt cttgggttaa tcagttttac tctctcgccc ccatgggaac
     6661 tgggaatggg cgtagaagag tgcagtaatg gctggagctt ttgtagcagg ccttgccggt
     6721 gatatagtca ccaatagcat tggttcactt gtgaacgctg gagccaatgc aataaaccaa
     6781 aaagtagact ttgaaaacaa caaacaacta cagcaggcct ctttcaacca tgacaaggaa
     6841 atgttgcaag ctcaaattca ggccacaaaa caattacagg ctgacatgat tgcgctcaga
     6901 caaggggtgt tgaccgcagg cggcttctcc cctactgatg cagcaagagg ggcggttaat
     6961 gcgcccatga cgcaagtctt ggactggaat gggacgaggt actgggcccc cggagccacc
     7021 aaaacaactg ctttctccgg tgggttcaca agctctccca acaccaggac tgttgatttg
     7081 cctaggaaaa catcaaccac accagccccc acacctatat ctagatctag ttcttctgct
     7141 tctactgttt ctacccgctc aacaattgtc agcgggactt ctggcctttc ttctttgact
     7201 aggagctctt ttaattccca gcccacctcc tcttcttctc ggactagcga atgggtgcgt
     7261 agtcaaaaca gggcgctgga gccctacatg aggggagcac tgcaaactgc ttacgtgacg
     7321 cctccctcta gtagagcatc cagcaatggc acagtctcaa ccgtgccaaa agaagttttg
     7381 gactcctgga catctgtgtt caacacccac agacaaccgc ttttcgctca tctccgtcgg
     7441 agaggggagt cacaggctta gtgaaaagat gatttttctt ccactt
//