Typing tool

Complete norovirus genomes

MK753016  GII.2
 GII.P16

Length: 7,521 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6712
ORF3: 6712..7491
LOCUS       MK753016                7521 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.2/Linn0365
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753016
VERSION     MK753016.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7521)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7521)
  AUTHORS   Barclay,L., Cannon,J.L., Tsaknaridis,L.J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7521
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Linn0365"
                     /isolate="Hu/US/2017/GII.P16-GII.2/Linn0365"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="20-Apr-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47708.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGVSGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     VSMARVELTPLSLYWRVVYTPQYLISPDTLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLV
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMRIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     4..999
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1000..2097
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2098..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6712
                     /gene="ORF2"
     CDS             5084..6712
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47709.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLSLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6712..7491
                     /gene="ORF3"
     CDS             6712..7491
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47710.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFDHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTVSSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaagaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaagcc
      121 ctcggggcta ggcccaaaca gcctgccccg agagacaaac cacaaaagcc cccaagacca
      181 ccaactcccg agttggtcaa gaggataccc cctcctccac ctaatggcga agaagaagaa
      241 gaaccagtca ttaggtatga ggttaagagt ggggtctctg gcctgcccga gctcacaaca
      301 gtcccccaac cggacgtggc caacacagca ttcagtgttc caccactgag cttgagagaa
      361 aacagggagg ccaaggaacc gctaacaggg gcaatattag agatgtggga tggagagata
      421 taccactatg gcctgtatgt ggagaaaggc ttagtgttgg gtgtgcacaa accacctgca
      481 gccgtaagca tggcaagagt ggagctgacg ccgctgtcat tgtactggcg tgtggtgtac
      541 actccccaat acctcatctc ccctgacact ctcaggaggc tcaacgggga ggcattccct
      601 tacaccgcct ttgacaacaa ctgctatgcc ttttgctgct gggtgttaga cctcaatgac
      661 tcatggctta gcaggaggat ggtgcaaaga acaacgggct tctttagacc ttaccaagag
      721 tggaacagaa aacccctgcc caccatggat gactccaaaa ttaagaaggt agcaaatata
      781 ttcctatgct cattgtccac attattcacc agacccataa aagacctcgt aggaaaaatt
      841 aaaccattaa acatattgaa tatcctggca acgtgtgact ggacttttgc cggaatagtg
      901 gagtctctga tattacttgc tgaactcttc ggagttttct ggacaccccc agatgtgtct
      961 gctatgatcg cccccttact cggggactac gagttgcagg ggccagaaga cctcgccgtt
     1021 gaactcgtgc ccgtggtaat gggggggatt ggtttggtgt tgggattcac caaagagaaa
     1081 attggcaaaa tgttatcctc agcagcatca acactcaggg cttgcaaaga tcttggtgcc
     1141 tatggcttag agatactcaa attggtcatg aagtggttct tcccaaagaa agaggaggcc
     1201 aatgagctag ccatggtgag ggccatagag gatgctgtac tagatcttga ggcaatagaa
     1261 aataaccaca tgacaaccct gttaaaagac aaagacagct tagcaacata catgaaaaca
     1321 ctggacatgg aggaggagaa agccaggagg ttgtccacaa aatctgcatc ccctgacata
     1381 gttgggacaa tcaacgccct gctggctcga atagcagcgg ccaggtcatt agtccacagg
     1441 gccaaggaag agctatctag caggataaga ccagtagttg ttatgatatc tggcaaacca
     1501 ggaataggca aaactcatct ggccagggag gtggcaagaa aggtggcatc cactctcaca
     1561 ggggatcaaa gagtcggact cataccaaga aacggtgtgg accattggga tgcatacaaa
     1621 ggtgagagag tcgtgctgtg ggacgactat ggcatgagta accccattca tgatgctctt
     1681 cgcatacaag aattggctga tacgtgtccc cttaccttaa attgtgacag aattgaaaat
     1741 aagggaaaag tttttgacag cgaggtcata ataattacga caaaccttgc caatccagcc
     1801 ccacttgatt atgttaactt tgaggcctgt tccaggagaa ttgatttcct ggtgtacgct
     1861 gaggcaccag aagtagaaaa ggcaaaacgg gactttcctg gtcagccaga tatgtggaag
     1921 gatgccttca agcccgactt ttcacacatc aagctacagc ttgcacccca gggcggcttt
     1981 gacaagaatg gcaacacccc acatgggaaa ggagtgatga agaccctcac taccggttct
     2041 ctgattgccc gtgcatcagg cctactgcat gagaggatgg atgaatttga actccaaggt
     2101 cccacaatca ccaccttcaa tttcgaccgg aacagaatca cagcattcag acaattggct
     2161 gcagaaaaca agtatgggtt ggtggatacc atgaaagttg gcaatcaact aaaaggagtg
     2221 aaaaccatgg aggaacttaa acaagcaatc aggaatgtga ccatcaagag gtgccggatc
     2281 atctacggtg gctccacgta tgaccttgaa tctgatggca agggcaaggt tttggtggaa
     2341 aaggtcaaga acacctctgt acagaccaac aacgagttgg ctggggccct gcaccatctc
     2401 aaacacgccc gaatcaggta ctatgtcaaa tgtgtgcaag aagcagtcta ttccatcata
     2461 caaattgccg gcgctgcgtt tgtcaccacg cgcattgctc gccgcatgaa catacaagaa
     2521 ctctggtcga agccacaatt agatcaaaat gaatcagaga ctaaggaaga ggcccccaag
     2581 tcagaagatg acgagttcat catatcttct aaggacatca aggaggaagg aaagaagggc
     2641 aaaaacaaaa ctggccgtgg caagaaacac actgcattct ccagcaaggg cttgagcgat
     2701 gaggagtatg acgagtacaa gaggataaga gaagagagga atgggaagta ctccatagag
     2761 gagtatcttc aagacagaga caggtactat gaggagctcg ccattgccaa ggccacggaa
     2821 gaagacttct gtgaagaaga ggagatcaaa atccgtcaga gaattttccg tcccaccagg
     2881 aaacaaagaa aggaagagag ggccacatta gggctagtaa caggttcaga aatcagaaaa
     2941 agaaaccctg atgacttcaa acccaaaggg aagctgtggg ccgatgacaa caggagtgtt
     3001 gactacaatg agaaactgga ctttgaggcc cccccaagca tatggtctag gattgtgagc
     3061 tttggttctg gctggggctt ctgggtgtca ccaagccttt tcataacatc aactcatgta
     3121 atccccgcag gcataacaga agcatttgga gtccccatca aacaaattca gatccacaaa
     3181 tcaggtgaat tttgccgatt cagattccca aagccaatta gaccagatgt aacagggatg
     3241 atcttggaag aaggtgcgcc tgagggcacc gtggcaactg tgctcatcaa acgccccacc
     3301 ggggagctca tgcctcttgc agccagaatg ggaacacacg caaccatgag aattcaaggc
     3361 cgcatggttg gcggacagat gggtatgttg ctcactggat caaatgctaa aggaatggat
     3421 ttgggaacaa ctcctggtga ctgtggctgc ccttacatct ataaaagagg caatgactat
     3481 atagtcattg gggtgcacac tgcagcagcc cgtggtggaa acaccgtcat ctgtgccaca
     3541 cagggaagtg agggtgaggc aacccttgag ggtggagatg acaaaggaac atactgtggg
     3601 gcacccattc taggccctgg gggtgcacca aaattgagca ccaaaaccaa attttggagg
     3661 tcatcgaaca cgccccttcc accagggaca tatgagcctg cctacctcgg tggccgtgat
     3721 ccgcgtgtta agggtgggcc ctccctgcag caggtaatga gagaccagtt gaagccattc
     3781 actgaaccca ggggcaaacc tccaagacca agtgtattgg aagcagccaa acaaaccatc
     3841 atcaatgtcc tcgaacaaac cctggaccct ccacaaaaat ggacatacgc acaggcgtgt
     3901 gcctcacttg acaaaaccac ctccagcggg cacccctatc acgtccgaaa gaatgaattc
     3961 tggaatggtg agaccttcac tggaaaattg gcagaccaag catcaaaagc aaacctaatg
     4021 tttgaggaag ggaaacacat gacaccagtg tacacagcag cactcaagga cgagctagtc
     4081 aagactgaga aaatctatgg aaagattaag aagagactgc tctggggctc tgacttgtcc
     4141 actatgatac ggtgcgctag gtcatttggt gggctcatgg acgagatgaa ggcacactgc
     4201 atatcactcc cagtccgagt tggcatgaat atgaatgaag atggcccaat aatatttgag
     4261 aaacattcca gatacaaata ccactatgat gcagactact ctcgttggga ttcaacacaa
     4321 cagagggcag tactagcagc agccttggaa attatggtca gattctctgc agaaccacaa
     4381 ttggcacaaa tagtcgctga ggatctgctg gcccctagtg tagtagatgt aggagacttt
     4441 aaaattacaa taaatgaagg gctcccctcc ggtgtgccat gcacttctca atggaactcc
     4501 atcgcacact ggctgctaac tctctgtgcc ttgtctgaag tcaccaaact gtcccctgac
     4561 attatacagg caaattccat gttctcattt tacggtgatg acgagattgt cagcaccgac
     4621 ataaaattgg accctgaaca gttaaccgcc aaattgaaag agtacggcct gaaaccaacc
     4681 cgcccagata aaaccgaggg acccctgatt atcagtgaag atttgaacgg tctcactttc
     4741 ctccgaagga cggtgactcg tgacccagct ggctggtttg gaaaattgga ccaaagctca
     4801 attttgaggc agatgtactg gactagagga ccaaatcatg aagaccccaa tgagacaatg
     4861 ataccccatt ctcaaagacc catacagctc atggcactgc ttggtgaagc ctctcttcac
     4921 ggaccctctt tctacagtaa aatcagtaaa ttggtcataa ctgaactcaa agaaggtggg
     4981 atggactttt acgtgccaag gcaagaaccc atgttcaggt ggatgaggtt ttctgacttg
     5041 agcacgtggg agggcgatcg caatctggct cccaattttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctactg atggtgcagc cggcctcgtg ccagaaagta acaatgaggt
     5161 catggctctt gaacccgtgg ctggtgccgc cttggcagcc ccggtcactg gtcaaacaaa
     5221 tattatagac ccttggatta gagcaaattt tgtccaggcc cccaatggtg aatttacagt
     5281 ctctccccgt aatgcccctg gtgaagtgct actgagtcta gagttgggtc cagaattaaa
     5341 tccttatctg gcacatttag caagaatgta caatgggtat gccggtggga tggaggtgca
     5401 ggtcatgttg gctgggaacg cgttcacagc cggcaagttg gtcttcgccg ccgtgccacc
     5461 tcacttcccg gttgaaaacc ttagcccaca gcaaatcacc atgttccctc atgtgatcat
     5521 agatgtgaga accttggaac ccgttttatt accactccct gatgttagaa ataatttctt
     5581 ccattataat cagaaagatg atcccaagat gagaattgtg gctatgcttt acacccccct
     5641 caggtctaat ggttcaggtg atgatgtgtt tacagtctcc tgcagagtgt tgactagacc
     5701 ttcccctgac tttgacttca catacctggt gccaccaaca gtggagtcta aaacaaaacc
     5761 attcaccctc ccaatcctca cacttgggga actttccaat tccaggttcc cagtgtccat
     5821 agaccagatg tataccagcc ctaatgaagt tatatcagtg cagtgtcaaa atggtaggtg
     5881 cacactggac ggggagctcc aggggacaac acaactccaa gtcagtggca tttgtgcttt
     5941 caaaggtgaa gtgaccgccc acttgcatga caatgatcac ctatataatg ttaccatcac
     6001 aaacttgaat gggtcccctt ttgatccctc cgaggatatc cctgcccctc tgggtgtgcc
     6061 tgacttccag ggaagggttt ttggtatcat ctcccaaaga gacaaacaca atagtcctgg
     6121 gcataatgaa ccagcaaaca ggggacacga cgctgtggtt cccacttaca cagcacagta
     6181 cactccaaaa ctgggacaaa ttcaaattgg cacatggcag actgacgatc ttacagtcaa
     6241 ccaaccagtc aaattcaccc cagttggact caatgacact gaacatttca accaatgggt
     6301 ggtccctagg tatgctggtg ccctaaacct taatacaaac cttgcccctt ctgttgctcc
     6361 agtatttcca ggagagcgtc tgctcttctt cagatcatac attcccctca agggcggtta
     6421 tggaaaccca gccattgatt gcctactacc acaagagtgg gtgcaacact tctatcagga
     6481 agcagcccct tcaatgagtg aggtggccct cgtcagatac atcaacccgg acactggtcg
     6541 ggcactgttt gaggccaagc tccacagagc tggtttcatg acagtctcga gcaacaccag
     6601 tgccccggtg gttgtgcctg ccaacggata cttcagattt gattcttggg tgaaccaatt
     6661 ctattctctc gcccccatgg gaactgggaa tgggcgtaga agggttcaat aatggctgga
     6721 gcttttgtag ctggtcttgc aggggatgtg ctcagcaatg ggcttagttc attaatcaat
     6781 gcaggtgcta atgcaataaa tcagagggca gaatttgatt ttaatcagaa attgcagcaa
     6841 aattcttttg atcatgataa ggagatgttg caggctcaga ttcaggcaac taagcagctg
     6901 caggcagaca tgatggctat aaaacaaggg gtcttgaccg ctggcggctt ttcccctgct
     6961 gatgcagcca gaggtgctgt gaacgcgccc atgacacaag cgctggattg gaatggtaca
     7021 aggtattggg caccaaactc catgaggacc acatcttact ctggaaaatt cacatcaacc
     7081 gccccagtga ggcaggccga cttccagcac acccaaagcc ggccttcgag tggctcctct
     7141 gtgtcttcct ttgccactca gtcttcaagg ccaactctga ccacaaccac tggttcctca
     7201 catggcacag tctcatcaaa ttcaactcgc agcacaagcc tctcccaatc aacggtctcc
     7261 agagccacat ctaggactgg tgagtgggtt agagatcaaa atagaaattt ggaaccctac
     7321 atgcatggtg ccttacagac agcctttgtc accccacctt ccagcagggc atctgacggg
     7381 acagtctcaa ccgtcccgaa aggtgttttg gactcctgga cacctgcgtt taacacccgc
     7441 aggcagccgc tttttgcaca cctccgtaag aggggggagt cacaagctta gtgaaaaggt
     7501 gaaaatttat ttaggatgaa t
//