Typing tool

Complete norovirus genomes

MK753015  GII.2
 GII.P2

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MK753015                7536 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Lane0946, complete
            genome.
ACCESSION   MK753015
VERSION     MK753015.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Barclay,L., Cannon,J.L., Tsaknaridis,L.J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Lane0946"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Lane0946"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="08-May-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47705.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTAGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNTLNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIRKCQIVYGGNTYTLESDGKGKVVVERVQSASVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLSEDADEATIKEGC
                     PKPRDEEEFIVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGYPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKVSINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47706.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPSEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47707.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPSSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMRGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgtcaaca gcaacaacga
       61 caacacaaaa tcttcaagtg acggaatgct taataacatg gccgtcaccc ttaaacgagc
      121 ccttggggcc cggcccaaac agccagcccc gagggaaaaa cccccaagac cccctagacc
      181 accaacacca gaattaatca aaagaatccc ccccccacca cctaatgatg gggacgaacc
      241 aaccgtgatg tttagcactg caggtggtgt gtctggccta cctgagctca caacagtcgg
      301 tcaaccacct gaagctaaca ctgcctttag tgtgcccccc cttagccaaa gggaaaacag
      361 ggacgctaag gaaccgttaa ctggggctat tctggaaatg tgggatgggg agatttatca
      421 ttatggactg tatgtggaaa aagggcttgt gctaggcgtg cacaagccgc cggctgccat
      481 cagcatagcc aaagtggaat taacacccct ctcactgtat tggaggcctg tgtacacgcc
      541 tcagtacctc atatctcctg ataccttgag gaaactccac ggtgagttat ttccctatac
      601 agcctttgaa aacaactgtt atgccttctg ttgttgggtt ttggacctca acgattcatg
      661 gctaagcagg aggatgatta gtaggactac tggcttcttc aggccctacc aagagtggaa
      721 caggaagcct ctcccaacta tggatgactc aaaattgaag aaggtcgcaa acatcgttct
      781 gtgtgcattg tcatcattgt tcactaggcc cattaaggat ataatcggca aacttaaacc
      841 ccttaacacc ctaaatattc tggcctcatg cgattggacc ttcgctggca tagtagaatc
      901 actaatcctc ttggctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcaccc ctcctcggcg actatgagct acaaggtccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gtgatgggtg ggataggtct ggtgttggga ttcaccaaag agaaaatagg
     1081 caagatgctc tcctctgcag cgtcaaccct gagggcttgc aaagatcttg gagcctatgg
     1141 attggagata ctgaaactag tcatgaaatg gtttttccca aagaaggatg aggccaacga
     1201 actggctatg gttagagcca ttgaagacgc tgtgttagac ctggaggcta ttgagaacaa
     1261 ccatatgacc actctattga aagacaagaa cagccttgca gcatacatga agaccctgga
     1321 catggaagag gaaaaagcta ggaagctatc caccaaatca gcctcccctg acattgtggg
     1381 cactataaac gccctgctgg ctaggatcgc tgccgcgcgt tccctagttc atagggccaa
     1441 ggaggagctc tccagcaggc caagaccggt cgttttgatg atctctggca agccagggat
     1501 aggaaagacc cacttggcca gagaactggc aaagaaaatt gcctcgacac tcacaggaga
     1561 ccaaagggtt ggtcttatcc cacggaatgg agttgaccat tgggacgcct acaaaggtga
     1621 gagagtggtg ctctgggatg actatggaat gagcaacccc atccacgatg cgctgaggct
     1681 gcaggaattg gcagacacat gtccattaac tctaaattgt gacaggattg aaaacaaagg
     1741 gaaagtcttc gacagcgacg cgatcataat caccaccaat ttggtcaacc ccgcgccgct
     1801 ggattatgtc aactttgagg cctgctccag acgtatagac ttccttgtgt atgctgatgc
     1861 cccagaagtc gagaaagcaa agcgggactt tcccggtcaa ccggacatgt ggaaagacgc
     1921 ctatcgatct gacttctcac acattaaact acaacttgca ccacaaggtg ggtttgacaa
     1981 aaatggtaac accccacatg gtaaaggagt gatgaagact ctcactgcca gctcgctggt
     2041 cgcacgtgcc tctggtctct tgcacgagag attagatgag tacgagttgc aaggtccgcc
     2101 cctctcaacc ttcaactttg accgtaacaa aatcgcagcg ttcagacaac tcgccgctga
     2161 aaacaagtac ggtctggtag acacgatgag ggtgggcaac cagctcagaa atgtcacgac
     2221 catggatgaa ctcaagaagg ctatcaagaa catcataatc agaaagtgcc agatagtcta
     2281 tggtggcaac acttacacgc ttgagtctga cggcaagggc aaggttgtag ttgagagggt
     2341 gcagagcgcc agcgtgcaaa tcaacaatga gatcgctggt gcagtacacc atcttagatg
     2401 tgccagaata aggtattatg tcaagtgtgt ccaagaggcc atatactcac tcctccagat
     2461 tgccggcacg gtgtttgtca cttcacgcat cgtaagccgc atgaacatcc aaaatctgtg
     2521 gtctaggcca ctatctgaag atgcagatga agccaccata aaagaggggt gccctaaacc
     2581 tagagatgaa gaagaattca tcgtctcctc agatgatatt aagccagagg gcaagaaagg
     2641 caaaaacaag agtggccggg gcaagaaaca cacggcattc tcaagtaaag ggctcagtga
     2701 tgaggagtac gaagagtata aaagaatcag agaggagaga aatggcaagt actccataga
     2761 ggaatatcta caggacagag acaagtacta tgaagaggtg gccattgcca gggcaaccga
     2821 agaagacttc tgtgaagaag aagaggttaa gattcgtcag aggatcttca ggccaacaag
     2881 aaagcaacgc aaggaagaaa gagccaacct tggcctcgtt accgggtctg agatcaggaa
     2941 gagaaaccca gatgacttca aaccaaaagg aaagctatgg gccgacgatg acaggagcgt
     3001 cgactacaat gaaagaatca gctttgaggc tccaccaagc atttggtcta gaattgtcaa
     3061 ctttggttct ggatgggggt tctgggtgtc acctagcctc ttcataacat caacacacgt
     3121 catacctcaa ggcataactg aggcctttgg tgtacccata aggcaggtgc aaatacacaa
     3181 atcgggcgag ttctgtcgct tgagattccc aaaacccatc agaacagatg tgtcaggcat
     3241 gatactggag gagggagcgc ccgaaggtac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctctag cagcaagaat gggaacccac gcgaccatga ggatacaagg
     3361 gcgcacagtg ggcggccaga tgggaatgtt gctcactggg tccaatgcaa agagcatgga
     3421 tcttggcacc acgcccggtg actgtgggtg tccctacatt tacaaaaggg gtaatgatta
     3481 catagtcatt ggagttcaca cagcagccgc tcgtggcgga aacactgtca tctgcgccac
     3541 acaaggtagt gagggtgagg ctactctcga gggtggtgac aataaaggaa catattgtgg
     3601 ggcaccaatc ttgggccccg gaaatgcccc aaaactgagc actaaaacca agttctggag
     3661 gtcctctaca acaccactcc cacccggcac gtacgagccg gcatatctgg gaggaaaaga
     3721 cccccgagtc aaaggtgggc catctctgca acaagtcatg cgagaccaac tgaagccatt
     3781 caccgaaccc cgtggcaagc caccaaaacc aagtgtcctt gaagctgcca aaaagacaat
     3841 tatcaatgtg ttagagcaaa caatagatcc cccacagaag tggacgtacg cgcaagcgtg
     3901 cgcgtctctt gacaaaacca catctagtgg gtacccccac cacgtgcgca aaaacgagca
     3961 ctggaatggg gaatctttca caggaaaatt ggctgatcag gcatcgaagg caaacctaat
     4021 gtttgaggag gggaaacaca tgaccccagt ttatacagct gcccttaagg atgagttggt
     4081 taaaactgag aaagtgtatg ggaagataaa gaagaggtta ctttggggct ctgacttggc
     4141 caccatggtg aggtgtgcgc gctcctttgg cggcttgatg gacgaactca aggcccactg
     4201 tgtgacactc ccgataaggg ttggcatgaa tatgaatgaa gatggaccaa tagtctttga
     4261 gaaacattcc agatacaggt atcactatga tgcagactac tccaggtggg attcaacaca
     4321 gcagagagcc gttctggccg cggccatgga gattatggtc aaattctcag cagaaccaca
     4381 attagcccaa atagttgcag aggatctgtt gtcgcccagt gttgttgacg tgggcgactt
     4441 caaagtttcc atcaatgaag gattaccatc gggtgtccct tgcacctctc aatggaactc
     4501 catcgcacac tggctcctca ccttgtgtgc cctttctgaa gttacagacc tctctcctga
     4561 cattgtgcaa gccaactccc tcttctcctt ctatggtgat gatgaaattg tgagtacaga
     4621 tatcaaatta gacccagaaa agttgacggg gaagttgaga gaatatggtc tcaaacccac
     4681 ccgtcctgac aaaactgagg gccccttgat tattagcgag gatctgaatg gcctgacctt
     4741 cctgaggaga actgtcaccc gcgaccctgc aggatggttt ggcaaactgg accaaagctc
     4801 catacttagg caattgtatt ggaccaaagg ccctaatcat gaagacccct ttgagtcaat
     4861 gattccacat tcccagaggc ccatacaact catgtcactc ttgggtgaag cagcactgca
     4921 tgaaccatca ttttacagca agatcagcaa gcttgtgata tctgagttga aagaaggtgg
     4981 aatggatttt tacgtgccca ggcaagaacc tatgtttagg tggatgagat tctcggattt
     5041 gagcacgtgg gagggcgatc gaaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aacaatgagg
     5161 tcatggctct tgaacccgtg gctggtgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tctctccccg aaatgcccct ggtgaagtgc tactgaatct agagttgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaatgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctggtaac gcgttcacag ccggcaagtt ggtcttcgcc gccgtgccac
     5461 ctcacttccc ggttgaaaac cttagcccac aacaaatcac catgttccct catgtgatca
     5521 tagatgtgag aaccttggaa cctgttttat taccactccc tgatgttagg aataatttct
     5581 tccattataa tcagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 tcaggtctaa tggttcaggt gatgatgtgt ttacagtctc ctgcagagtg ttgactagac
     5701 cttcccctga ttttgacttt acatacctgg tgccaccaac agtggagtct aaaacaaaac
     5761 cattcaccct cccaatcctc acacttgggg aactttccaa ttctaggttc ccagtgtcca
     5821 tagaccagat gtacaccagc cctagtgaag ttatatcagt gcagtgtcaa aatggtaggt
     5881 gcacattgga cggggagctc caagggacaa cacaactcca agtcagtggc atttgtgctt
     5941 tcaaaggtga agtgaccgcc cacttgcatg acaatgatca cctatataat gtcaccatca
     6001 caaatttgaa tgggtcccct tttgatccct ccgaggatat ccccgccccc ctgggtgtgc
     6061 ctgatttcca gggaagggtc tttggtatca tctcccaaag agacaaacac aatagtcccg
     6121 ggcataatga gccagcaaac aggggacacg acgctgtggt ccctacttac acagcacagt
     6181 acactccaaa actgggacaa attcaaattg gcacatggca gactgacgac cttacagtca
     6241 atcaaccagt caaattcacc ccagttggac tcaatgacac tgaacatttt aaccaatggg
     6301 tggtccctag gtatgctggt gccctaaatc tcaacacaaa ccttgcccct tctgttgctc
     6361 cagtatttcc aggagagcgc ctgctcttct tcagatcata cattcccctc aagggtggtt
     6421 atggaaaccc agccattgat tgcctactac cacaagagtg ggtgcaacac ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc ttgtcagata catcaacccg gatactggtc
     6541 gggcactgtt tgaggccaag cttcacagag ctggtttcat gacagtctcg agcaacacca
     6601 gtgccccggt ggttgtgcct gccaacggat acttcagatt tgattcttgg gtgaatcaat
     6661 tctattctct cgcccccatg ggaactggga atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagtaat gggctcagtt cattaatcaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaaccaga aattgcagca
     6841 aaattctttt aatcatgaca aggagatgtt gcaggctcag attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta ttaaacaagg ggtcttgacc gctggcggtt tttcccctgc
     6961 tgatgcagcc agaggtgctg tgaacgcgcc catgacacag gcgctggatt ggaatggcac
     7021 aagatattgg gcaccaagct ccatgaggac cacatcttat tctggaaaat tcacatcaac
     7081 cgccccagtg aggcaggctg actttcagca cacccaaagc cggccttcga gtggttcttc
     7141 tgtgtcttcc tttgccactc agtcttcaag gccaactctg accacaacca ctggctcctc
     7201 acatggtaca gcctcatcaa attcaactcg cagcacaagc ctctcccaat caacggtctc
     7261 cagagctaca tctaggactg gtgagtgggt tagggatcaa aatagaaatt tggaacccta
     7321 catgcgtggt gccttacaga cagcctttgt caccccacct tccagcaggg cgtctgacgg
     7381 gacagtctca accgtcccga aaggtgtttt ggactcctgg acacctgcgt tcaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaatcta tttaggatga attgattcta cctttt
//