Typing tool

Complete norovirus genomes

MK753012  GII.2
 GII.P2

Length: 7,505 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6712
ORF3: 6712..7491
LOCUS       MK753012                7505 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Douglas0940
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753012
VERSION     MK753012.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7505)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7505)
  AUTHORS   Barclay,L., Cannon,J.L., Tsaknaridis,L.J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7505
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Douglas0940"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Douglas0940"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="09-Mar-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47696.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELVKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     VAKVELTPLSLYWRPVYTPQYLIPPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIRNIIIRKCQIVYGGNTYTLESDGKGKVVVERVQSTSVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLTEEVDEATMKEGC
                     PKPREEEEFIVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     4..993
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     994..2091
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2092..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6712
                     /gene="ORF2"
     CDS             5084..6712
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47697.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6712..7491
                     /gene="ORF3"
     CDS             6712..7491
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47698.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLAAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTAYSGRFTSTTPVRQTDLQHTQSRPTSGSSVSSFATQSSRPTLTTTT
                     GSSLGTASSNSTRSTNLSQSTVSRATSRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttct gctgccgctg ctgttaacag caacaacgac
       61 aacacaaaat cttcaagtga cggaatgctt aacaacatgg ccgtcaccct taaacgagcc
      121 cttggggccc ggcccaaaca gccggccccg agggagaaac ccccaaggcc ccctaggcca
      181 ccaacaccag aattggtcaa aagaatcccc cccccaccgc ccaatgatgg ggacgaacca
      241 accgtgatgt ttagcactgt aggtggcgtg tctggcctac ctgagctcac aacagttggc
      301 caaccacctg aagctaacac ggcctttagt gtgcctcccc tcagccaaag ggagaatagg
      361 gacgctaagg aaccgttaac tggaaccatt ctggaaatgt gggatgggga gatttatcat
      421 tatggactgt atgtggaaaa agggcttgtg ttaggcgtgc acaagccgcc ggctgccatc
      481 agcgtagcca aagtggagtt aacacccctc tcactgtact ggagacctgt ttacacgcct
      541 cagtacctta tacctcctga caccttgagg aaactccatg gtgaattgtt tccctacaca
      601 gcctttgaaa acaactgtta tgccttctgc tgttgggttt tggatcttaa tgattcatgg
      661 ttaagcagga ggatgattag taggactact ggctttttca ggccctacca ggagtggaac
      721 aggaagcccc tcccgactat ggatgactca aaactgaaga aggtcgcaaa cattgtcctg
      781 tgtgcattgt catcattgtt cactagaccc attaaggaca taattggcaa acttaaaccc
      841 ctcaacatcc taaatatcct ggcctcatgc gactggacct tcgctggcat agtggagtca
      901 ctaatcctct tggctgaact ctttgatgtg ttctggacac ccccagatgt gtctgcaatg
      961 atcgcacccc tcctcggtga ctacgagctg caaggccccg aagacatcgc tgtggagctc
     1021 gtgcccgttg ttatgggtgg gataggcttg gtgttgggat tcaccaaaga gaaaataggt
     1081 aagatgctct cctctgcagc gtcaactctg agggcatgta aggatcttgg agcctacgga
     1141 ttggagatct tgaaattagt catgaaatgg tttttcccaa agaaagatga ggccaacgag
     1201 ctggctatgg ttagagccat tgaagacgct gtgttagacc tggaggccat tgagaacaac
     1261 catatgacca ctctattgaa agacaagaac agtcttgcag cctacatgaa gaccctggac
     1321 atggaagagg aaaaagctag gaaattatct accaaatcag catcccctga cattgtgggc
     1381 accataaacg ccctactggc taggatcgct gccgcacgtt ccttagttca tagggccaag
     1441 gaggagctct ccagtagacc aaggccagtt gttctgatga tctctggcaa accagggata
     1501 ggaaagaccc atctggccag agaattggca aagaaaattg catcaacact cacgggagac
     1561 caaagggtag gcctcatccc acggaatgga gttgaccatt gggacgccta caaaggtgag
     1621 agagtggtgc tctgggatga ctacggtatg agcaacccca tccacgatgc actaaggttg
     1681 caggaattgg cagacacatg tccactaact ctgaattgtg acaggattga gaacaagggg
     1741 aaagtcttcg acagtgacgc aatcataatc accaccaatc tggtcaatcc cgcgccgctg
     1801 gactatgtca actttgaggc ttgctccaga cgtatagact tccttgtgta tgctgatgcc
     1861 ccagaagtcg agaaagcaaa gcgggacttc cccggtcaac cggacatgtg gaaggacgcc
     1921 tatcgttctg atttctcaca tatcaaattg caacttgcac cacaaggtgg gtttgacaaa
     1981 aatggcaaca ccccacatgg taagggagtg atgaagactc tcactgccag ttcactggtt
     2041 gctcgtgctt ctggtctctt gcacgagaga ttagatgagt acgagttaca gggtccgccc
     2101 ctttcaacct tcaactttga ccgcaacaaa attgcggcgt tcagacaact cgccgctgaa
     2161 aataagtatg gtctggtgga cacgatgagg gtgggcaacc agctcaggaa tgtcacgacc
     2221 atggatgaac tcaagaaggc tatcagaaac attataatca ggaagtgcca gatagtctat
     2281 ggcggcaaca cttacacgct tgagtctgac ggcaagggta aggttgttgt tgagagggtg
     2341 cagagcacca gcgtgcaaat caacaatgag atcgctggtg cagtgcatca ccttagatgt
     2401 gccaggataa ggtattatgt caagtgtgta caagaggcca tatactcact cctccaaatt
     2461 gccggcacgg tgtttgtcac ttcacgcatc gtgagccgca tgaacattca aaacttgtgg
     2521 tccagaccat taactgaaga agtagatgag gcaaccatga aagaggggtg ccccaaacct
     2581 agggaagaag aggagtttat cgtctcttca gatgacatca agccagaggg taagaaaggt
     2641 aagaacaaga gtggccgggg caagaaacac acggcattct caagtaaagg tctcagtgat
     2701 gaggagtatg aggagtacaa aagaatcaga gaggagagaa acggcaagta ctccatagag
     2761 gaatacctac aggacagaga caaatactat gaagaggtgg ccattgccag ggcaactgaa
     2821 gaagacttct gtgaagaaga agaggttaag attcgccaga gaatcttcag gccaacaaga
     2881 aagcaacgca aggaagaaag agccaacctt ggcctcgtca ctggatctga gatcaggaag
     2941 aggaacccag atgacttcaa accaaaagga aagctgtggg ccgacgatga taggagcgtc
     3001 gactacaacg aaagaatcag ctttgaggcc ccaccgagca tttggtccag aattgttaac
     3061 tttggttctg gatgggggtt ctgggtgtca cccagtctct tcataacatc aacacatgtc
     3121 atacctcaag gcataactga ggcctttggt gtgcccataa ggcaggttca aatacacaag
     3181 tcgggcgaat tctgtcgtct gagattccca aaacccatca ggacagatgt gtcaggtatg
     3241 atactggagg agggagcgcc tgaaggcact gttgccacca tactcatcaa aagaaccact
     3301 ggagagctga tgcctcttgc agcaagaatg ggcacccacg cgaccatgag aatacaagga
     3361 cgcacggtgg gcggccagat ggggatgctg cttactgggt ctaacgcaaa aagcatggat
     3421 cttggcacca cgcccggcga ctgtgggtgc ccctacattt acaaaagggg caacgactat
     3481 atagtcattg gagtccacac agcagccgct cgtggcggaa acactgtcat ctgcgccaca
     3541 caaggtagtg agggtgaggc aacactcgag ggtggtgata acaaaggaac atactgtggg
     3601 gcaccaatcc taggccccgg gaatgcccca aaactgagca ccaaaactaa gttctggagg
     3661 tcctcaacaa caccactccc acccggcacg tacgaaccgg catacctggg aggaaaagac
     3721 ccccgagtca aaggtggacc atctctgcaa caagttatgc gagaccaact gaagccattt
     3781 actgagcccc gtggtaagcc accaaaacca agtgtccttg aagctgctaa aaagacaatc
     3841 atcaatgtgc tagaacaaac aatagatccc ccacaaaagt ggacgtacgc gcaagcgtgc
     3901 gcgtctcttg acaaaaccac atctagtgga ttccctcacc acgtgcgcaa gaacgagcac
     3961 tggaatgggg aatctttcac aggaaaattg gctgatcagg catcaaaagc aaacttaatg
     4021 tttgaagagg ggaagcacat gaccccagtt tacacagctg cccttaagga cgagctggtc
     4081 aaaactgaga aagtgtatgg gaaaataaag aagaggttgc tttggggctc tgacctggcc
     4141 accatggtgc ggtgcgcgcg ctcctttggt ggtttgatgg acgagctcaa agcccactgt
     4201 gtgacacttc caataagggt tggcatgaac atgaatgaag atggaccaat agtctttgag
     4261 aaacactcca gatataggta ccactatgat gcagactatt ccaggtggga ctcaacacag
     4321 caaagagccg ttctggccgc ggccatggag atcatggtta aattctcagc agaaccacaa
     4381 ctagcccaaa tagttgcaga ggatctattg tcgcctagtg tagttgacgt gggcgacttc
     4441 aaaatttcca tcaatgaagg gttgccatcg ggtgtccctt gcacctccca gtggaattcc
     4501 atcgcacact ggctcctcac tttgtgtgcc ctctctgagg tcacagacct ctctcctgac
     4561 attgtacagg ccaactccct cttctccttc tatggagatg atgaaattgt gagcacagat
     4621 attaaattag acccagaaaa actaacgggg aagttgagag aatatggtct caaacctact
     4681 cgtcctgaca aaactgaggg ccccctaatc atcagtgagg atctgaatgg cctgactttc
     4741 ctgaggagaa ccgtcacccg tgaccctgca gggtggtttg gcaaactgga ccaaagctcc
     4801 atacttagac aattgtattg gaccaagggc cccaatcatg aagacccctt tgagtcaatg
     4861 atcccacact cccaaagacc catacaactc atgtcactct tgggtgaggc ggcactgcat
     4921 gaaccatcat tctacagcaa gattagcaag cttgtgatat ctgaattgaa agaaggtgga
     4981 atggattttt acgtgcccag gcaagaacct atgttcaggt ggatgagatt ctcggatttg
     5041 agcacgtggg agggcgatcg caatcttgct cccagtcttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctactg atggtgcagc cggcctcgtg ccagaaagta ataatgaggt
     5161 catggctctt gaacccgtgg ctggtgccgc tttggcagcc ccagtcactg gtcaaacaaa
     5221 tattatagac ccttggatta gagcaaattt tgtccaggcc cccaatggtg aattcacagt
     5281 ctccccccgt aatgcccctg gtgaagtgct actaaatctg gagttgggtc cggaattaaa
     5341 tccttatctg gcacacttat caagaatgta caacgggtat gccggtggaa tggaggtgca
     5401 ggtcatgttg gctgggaacg cgttcacagc cggcaagttg gtcttcgccg ccgtgccacc
     5461 ccacttcccg gttgaaaacc ttagcccaca acaaattacc atgttccctc atgtgattat
     5521 agatgtaagg actttggaac ctgttttatt accactccct gatgttagaa ataatttctt
     5581 ccattacaat cagaaagatg atcccaagat gagaattgtg gctatgcttt atacccccct
     5641 tagatctaat ggctcaggtg acgatgtgtt cacagtctcc tgtagggtgt tgactagacc
     5701 ctcccctgac tttgatttca cgtatctggt gccaccaaca gtggagtcta aaacaaaacc
     5761 attcaccctc ccaatcctca cacttgggga actttccaat tctagattcc cagtgtctat
     5821 agaccagatg tacaccagtc ctaatgaagt tatatcagtg cagtgtcaaa atggtaggtg
     5881 cacattggac ggggagctcc aagggacaac acaactccag gtcagtggta tttgtgcttt
     5941 caagggagaa gtgaccgccc acttgcatga caatgatcac ctatacaata tcaccatcac
     6001 aaatctgaat ggatcccctt ttgacccctc tgaggacatc cctgcccctt tgggcgtgcc
     6061 tgactttcag ggaagggtct ttggtatcat ctcccaaaga gacaaacaca atagccctgg
     6121 acataatgaa ccagcaaaca ggggacacga tgctgtggtc cctacttaca cagcacagta
     6181 tactccaaaa ctgggtcaaa ttcaaattgg cacatggcag actgacgatc ttactgtcaa
     6241 ccaaccagta aaattcaccc cagttggact caatgatact gaacatttta accaatgggt
     6301 ggttccccga tatgctggtg ccctaaatct caacacaaac cttgcccctt ctgttgcccc
     6361 agtatttcca ggggagcgcc ttctcttttt cagatcatac atccccctca agggtggcta
     6421 tggaaaccca gccattgatt gtctactacc acaagagtgg gtacaacatt tctatcagga
     6481 agctgcccct tcaatgagtg aggtggccct tgtcaggtac atcaacccag acactggccg
     6541 ggcactgttt gaggccaagc tccacagagc tggtttcatg acggtctcga gcaacaccag
     6601 tgccccggtg gtcgtgcctg ccaatggata cttcagattt gactcttggg tgaaccagtt
     6661 ttattctctc gcccccatgg gaactgggaa tgggcgtaga agggttcaat aatggctgga
     6721 gcttttgtag ctggtcttgc aggggacgtg ctcagcaatg ggctcagttc actaatcaat
     6781 gcaggcgcta atgcaataaa tcagagggca gaatttgatt ttaaccagaa attacagcaa
     6841 aattctttta atcatgataa ggagatgcta caggctcaaa ttcaggcaac caagcagctg
     6901 caagcagaca tgatggctat aaagcagggg gtcctggccg ctggcggctt ttcccctgct
     6961 gatgcagcca gaggtgctgt gaatgcgccc atgacacagg cgctggattg gaatggcaca
     7021 aggtattggg caccaggctc catgaggacc acagcctact ctgggagatt cacatcaacc
     7081 accccagtga ggcagaccga ccttcagcac acccaaagcc ggcctacgag tggctcttct
     7141 gtatcctcct ttgccactca gtcttcaagg ccgactttga ccacaaccac tgggtcctca
     7201 cttggcacag cttcatcaaa ttcgactcgc agtactaacc tctcccaatc aacagtctcc
     7261 agagctacat ctaggactag tgagtgggtt agagaccaaa atagaaattt ggaaccctac
     7321 atgcatggtg ccttacagac agcctttgtc accccacctt ccagcagggc gtctgacggg
     7381 acagtctcaa ccgtcccgaa aggtgttttg gactcctgga cacctgcgtt caacacccgc
     7441 aggcagccgc tctttgcaca cctccgtaag aggggggagt cacaagctta gtgaaaaggt
     7501 gaaaa
//