Typing tool

Complete norovirus genomes

MK753008  GII.13
 GII.P16

Length: 7,456 | 3 CDS

ORF1: 3..5099
ORF2: 5080..6708
ORF3: 6708..7439
LOCUS       MK753008                7456 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2013/GII.P16-GII.13/Multnomah0890
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753008
VERSION     MK753008.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7456)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7456)
  AUTHORS   Barclay,L., Cannon,J.L., Tsaknaridis,L.J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7456
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Multnomah0890"
                     /isolate="Hu/US/2013/GII.P16-GII.13/Multnomah0890"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="04-Dec-2013"
                     /note="genotype: GII.P16-GII.13"
     gene            3..5099
                     /gene="ORF1"
     CDS             3..5099
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47684.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELIKRMPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMVQRTTGFFRPYQEWNRKPLPTVDDSKIKKVANIFLCSLSTLFTRPIKDLMG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKGAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRIAAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVTIKRCRIIYGGSTYDLESDGKGRVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIVRRMNIQELWSKPPLDQNESEAKEEA
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERVTLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRSDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCITLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     3..995
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     996..2093
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2094..2624
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2625..3023
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3024..3566
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3567..5096
                     /gene="ORF1"
                     /product="RdRp"
     gene            5080..6708
                     /gene="ORF2"
     CDS             5080..6708
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47685.1"
                     /translation="MKMASNDAAPSNDGAASLVPEAINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANSGDNWDQNLLQLTYPSGASYDPTDEVPAPLGTQDFSGMLYG
                     VLTQDNVSEGTGEAKNAKGVYISTTSGRFTPKIGTIGLHSITENVHPNQQSRFTPVGV
                     AQNENTPFQQWVLPHYAGALALNTNLAPAVAPTFPGEQLLFFRSRVPCVQGLRGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGTYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6708..7439
                     /gene="ORF3"
     CDS             6708..7439
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47686.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIDATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRAQVKSPSNSSQRTAAPSSIRSLSTQSTSLGSTS
                     SGGSSTISSSSRTANWVQQQRALSPYMQGALQTAYVTPPSSRASSMSSVSTVPKGVLD
                     SWTPVFNTRRQPLFAHLRKRGESQV"
ORIGIN      
        1 gaatgaagat ggcgtctaac gacgctaccg ttgccgttgc ttgcaacaac aacaacgaca
       61 aggaaaaatc ttcaggtgaa ggcttattca caaacatgtc ttccacctta aagaaagccc
      121 tcggggcccg gcccaaacag cctgccccga gggacaactc acaaaagccc ccaagaccac
      181 caactcccga gttgattaag aggatgcctc ctcccccacc taacggagaa gaggaagaac
      241 cagtcattag gtatgaggtt aagagtggaa tctctggcct gcccgagctc acaacagtcc
      301 ctcaaccgga tgtggccaac acggcattca gtgtcccacc gctgagcttg agagaaaaca
      361 gggaggccaa ggaaccgctg acaggggcaa tattagagat gtgggatgga gagatatacc
      421 actatggcct gtacgtggag aaaggcttag tgttgggtgt gcacaaacca cctgcagcta
      481 taagcatggc aaaagtggag ctgacgccgt tgtcattgta ctggcgtgtg gtctacaccc
      541 cccaatacct catctcccct gaaactctca ggaggctcaa cggagaggca ttcccctaca
      601 ctgcctttga caacaactgc tatgcctttt gctgttgggt attagacctc aatgactcat
      661 ggcttagcag gaggatggtg caaagaacaa caggcttctt cagaccttac caagagtgga
      721 acagaaaacc cctgcccact gtggatgact ccaaaatcaa gaaggtggca aacatattcc
      781 tgtgctcact gtccacgttg ttcaccagac ctataaaaga cctcatggga aaaattaagc
      841 cattaaacat cttgaacatc ctggcaacgt gtgactggac attcgccgga atagtggagt
      901 ctcttatatt acttgctgaa ctctttggag ttttctggac acccccagat gtgtctgcta
      961 tgatcgctcc tttacttgga gactacgagt tgcaagggcc agaagacctt gccgttgagc
     1021 tcgtacctgt agtaatggga gggattggtt tggtgttggg attcaccaaa gagaaaattg
     1081 gaaaaatgtt gtcctcagca gcatcaacgc tcagggcttg taaagatctt ggtgcctatg
     1141 gcttagagat actcaaactg gtcatgaagt ggttcttccc aaagaaagaa gaggccaatg
     1201 agctagccat ggtgagagct atagaggatg ctgtactaga tcttgaggca atagaaaata
     1261 atcacatgac aactctgttg aaagacaaag acagcctagc aacctacatg aaaacactag
     1321 acatggagga ggaaaaggcc agaagattgt ccacaaaatc tgcatcccct gacatagttg
     1381 ggacgatcaa cgccctgctg gctcgaatag cagcggctag gtcactagtc cacagggcca
     1441 aggaggagtt atctagcagg ataagaccag tggttgttat gatatctggc aaaccaggga
     1501 taggcaaaac tcatttggcc agggaagtgg caagaaaggt ggcatccact ctcacagggg
     1561 atcaaagagt cgggctcata ccgagaaacg gtgtggacca ttgggatgca tacaaaggtg
     1621 agagagtcgt gctgtgggac gactatggca tgagcaaccc cattcatgat gctctgcgca
     1681 tacaagaatt ggctgacacg tgtcccctta ccttaaattg tgacagaatt gaaaataagg
     1741 gaaaagtttt tgacagtgaa gtcataataa tcacaacaaa ccttgccaat ccagctccac
     1801 ttgattatgt caactttgag gcctgttcca ggagaattga cttcctggtg tacgccgagg
     1861 caccagaagt agaaaaggca aaacgagact ttcctggtca accagatatg tggaagggcg
     1921 ccttcaagtc ggacttttca catatcaagc tgcaacttgc acctcagggc ggctttgaca
     1981 agaatggcaa caccccacat gggaaaggag tgatgaagac cctcaccacc ggttcactga
     2041 tcgcccgtgc atcaggctta ctgcatgaga ggatggatga atttgaactc caaggcccca
     2101 cagtcaccac ctttaatttt gaccggaaca gaatcgctgc attcagacaa ttggctgcag
     2161 aaaacaagta tggattggtg gacaccatga gagttggcaa tcaattaaaa ggggtgaaaa
     2221 ccatggaaga actcaaacaa gcaatcaaga atgtgaccat caagaggtgc cggatcatct
     2281 acggcggctc cacgtatgac cttgaatctg atggtaaggg cagagttctg gtggaaaagg
     2341 tcaagaacac ctctgtacag accaacaacg agttggccgg agccctgcat cacctcaaac
     2401 atgcccgaat caggtactat gtcaaatgtg tgcaagaagc agtctactct attatacaaa
     2461 tcgccggcgc tgcgtttgtc accacacgca tagtacgccg catgaacata caagagcttt
     2521 ggtcgaagcc accattagat caaaatgaat cagaggctaa ggaagaggcc cccaagtcag
     2581 aagatgacga gttcatcata tcttctaagg acatcaagga ggaaggaaag aagggcaaaa
     2641 acaaaactgg ccgtggcaag aaacatactg cattctctag caagggcttg agcgatgagg
     2701 agtacgacga gtacaagagg ataagagaag agagaaatgg gaagtactct atagaggagt
     2761 atcttcaaga cagagacagg tactatgagg aactcgccat cgccaaggcc acggaagaag
     2821 acttctgtga ggaggaggag atcaaaatcc gtcagaggat cttccgtccc accaggaagc
     2881 aaaggaagga agagagggtc acactagggc tagtaactgg ttcagaaatc agaaaaagaa
     2941 accctgatga cttcaaacct aaagggaaac tgtgggctga tgacaacaga agtgttgact
     3001 acaatgagaa actggacttt gaggcccccc caagcatatg gtctaggatt gtgagttttg
     3061 gttctggttg gggtttctgg gtgtcaccaa gcctgttcat aacatcaact cacgtaatcc
     3121 ctgcaggcat aacagaggca tttggtgtcc ccatcaaaca aatccaggtc cacaaatcag
     3181 gtgaattttg ccggttcaga ttcccaaaac caattagatc agatgtgaca ggaatgatct
     3241 tggaagaagg tgcgcctgag ggcaccgtgg caaccgtgct catcaaacgc cctaccggag
     3301 agctcatgcc ccttgcagcc agaatgggaa cacacgcaac catgaaaatt cagggccgca
     3361 tggttggcgg acagatgggt atgttgctca ctggttcaaa tgctaaagga atggatttag
     3421 gaacaactcc tggtgattgt ggctgtccct acatctacaa aaggggcaat gactatatag
     3481 tcattggggt gcacacagca gcagcccgtg gtggaaacac cgtcatctgt gccacacagg
     3541 gaagtgaggg tgaggcaacc cttgagggtg gagatgacaa aggaacatac tgtggggcac
     3601 ccattctagg ccccgggggg gcaccaaaat tgagcaccaa aaccaaattt tggaggtcat
     3661 cgaacacgcc tcttccacca gggacgtatg agcctgccta cctcggtggc cgtgacccgc
     3721 gtgttaaggg tgggccctcc ttgcagcagg taatgagaga ccagttgaag ccattcaccg
     3781 agcccagggg taaacctcca agaccaagtg tgttggaagc agccaaacaa accatcatca
     3841 acgtcctcga acaaactctg gaccctccac aaaaatggac atacgcacag gcgtgtgctt
     3901 cacttgacaa aaccacctcc agcgggcacc cccaccatgt ccgaaagaat gaattctgga
     3961 atggtgagac cttcactggt aaattggcag accaagcatc aaaagcaaat ctaatgtttg
     4021 aggaagggaa acacatgaca ccagtgtata cagcagccct caaggatgag ctggtcaaga
     4081 ctgacaaagt ctatggaaag atcaagaaga gactgctctg gggctctgac ttgtccacca
     4141 tgatccggtg cgccaggtcc tttggtgggc tcatggatga gatgaaagca cactgcataa
     4201 cactcccagt ccgagttggc atgaacatga atgaagatgg tccaataata tttgagaagc
     4261 actccagata caagtatcac tatgatgcag attactcccg ctgggattca acacaacaga
     4321 gggcagtgct agcagcagcc ttggagatca tggtcaggtt ctctgcagag ccacaattgg
     4381 cacaaatagt cgctgaggat ctgctggccc ccagtgtggt agatgtagga gactttaaaa
     4441 tttcaataaa tgaagggctc ccctctggtg taccatgcac ttctcaatgg aattccatcg
     4501 cacactggct gctaaccctc tgcgccttgt ctgaagtcac caaactgtcc cctgacatcg
     4561 tacaggcaaa ctccatgttc tcattttacg gtgatgacga gattgtcagc accgatataa
     4621 aattggaccc tgaaaagtta accaccaaat tgaaggagta cggcctgaaa ccaactcgcc
     4681 cagacaaaac cgagggaccc ctgatcatca gtgaggattt gaacggactc actttcctcc
     4741 ggagaacggt gactcgtgac ccagctggct ggtttggaaa attggaccaa agctcaatat
     4801 tgaggcagat gtactggact agaggaccaa atcatgaaga ccccaacgag acaatgatac
     4861 cccactctca aagacccata cagctcatgg cactgcttgg tgaggcctcc cttcacggac
     4921 cctctttcta cagcaaaatt agtaagttgg tcataactga actcaaagaa ggtgggatgg
     4981 atttttacgt gccaaggcag gaacccatgt tcaggtggat gaggttttct gacttgagca
     5041 cgtgggaggg cgatcgcaat ctggctccca attttgtgaa tgaagatggc gtcgaatgac
     5101 gccgctccat cgaatgatgg tgcagctagt ctcgtaccag aggccattaa tgagactatg
     5161 ccattggaac ccgttgctgg cgcatctatt gctgccccag tggcgggaca aactaacata
     5221 attgacccct ggataagaac aaattttgtg caagccccta atggagagtt cacagtatca
     5281 ccgagaaatt cccctggaga gattctatta aatttagagt taggaccaga tttgaatcct
     5341 tatttggccc atctgtcaag gatgtacaat ggatatgctg gaggtgttga ggtgcaagtg
     5401 cttcttgctg ggaacgcgtt cacagcagga aagatattat ttgcagcaat cccacccaac
     5461 tttcctgtag atatgattag cccagctcaa attactatgc ttccccattt gattgtagat
     5521 gttaggacat tggaacctat tatgataccc ttaccagatg ttaggaatgt gttctatcat
     5581 tttaataatc aaccccaacc taggatgaga ttagtggcta tgctctatac cccattgaga
     5641 tctaatggtt caggagatga tgtctttact gtgtcttgta gagtgttgac taggccaacc
     5701 cctgactttg aattcattta cctagtgcct ccctctgtag agtccaaaac taaaccattc
     5761 acacttccaa tattgaccat ttctgaacta accaactccc ggtttcccat cccaattgag
     5821 caactgtaca cggccccaaa tgagaataat gttgtacagt gtcaaaatgg aaggtgcacc
     5881 ttggatggag agcttcaggg caccacccag ctgctatcaa gtgcagtttg ctcttacagg
     5941 ggtaggactg tggctaacag tggggacaat tgggaccaga atttgctcca gctgacctac
     6001 ccaagcggtg caagctacga ccccactgat gaagtaccag cacccttggg cacccaggat
     6061 ttcagtggga tgttgtatgg ggtgttaacc caagacaatg taagtgaggg tacaggggag
     6121 gccaaaaatg ctaagggagt atacatatcc accaccagtg gaagattcac cccaaaaatt
     6181 ggaacaattg gattgcattc aataactgaa aatgtgcacc ccaatcagca atcacggttc
     6241 acccccgttg gagttgctca gaatgaaaat acccccttcc agcaatgggt tctaccacac
     6301 tacgcaggtg ctctcgctct aaacaccaat ttggcacccg ctgttgcccc gactttccct
     6361 ggcgagcaat tactgttctt caggtcccgt gttccatgtg ttcaaggtct gcgggggcag
     6421 gatgctttca tagattgtct cctacctcaa gagtgggtga accattttta tcaagaggct
     6481 gctccctccc aagcagacgt tgccctcatc aggtatgtca accctgatac tggtcgcacg
     6541 ctgtttgagg ctaaattgca caggtcaggt ttcattactg tgtcacacac tggtacctac
     6601 ccccttgtgg tccccccaaa tggtcatttc aggtttgatt cttgggttaa ccaattctac
     6661 tcactcgccc ccatgggaac tggcaatggg cgtagaagag ttcaataatg gcaggagcat
     6721 ttatagctgg tctagccggt gacatgctga cttctgctgt tggttcactg acctctgcag
     6781 gagccaatgc catcaatcag aaattgaatt ttgattacaa taaacaactc caaaatgcat
     6841 cctttcaaca tgataaggaa atgttgcagg cccaaattga tgctacgaag aagctccaat
     6901 cagaaatgat tgcaattaag catggggttt tgaccgcggg cggcttttcc ccagctgatg
     6961 cagccagagg ggcagtcaac gccccaatga ctcgagtgtt ggattggtca gggacacgct
     7021 actacgctcc aaattctgtg caaaccacca gttattccgg gcaattcacc ccctcgccag
     7081 tccatcgggc gcaggtgaag tccccttcca attcatctca gcggactgca gctccaagca
     7141 gtatccgcag cctgtcaacc caatcaactt ctttaggctc cacctcctca ggggggtcct
     7201 ctacaatctc ctctagttcg aggacagcaa actgggtgca acaacaaagg gctcttagcc
     7261 cgtacatgca gggagccctg cagacggcat acgtcacacc gccgtctagt agggcttcca
     7321 gtatgagctc tgtctcaaca gtgcccaaag gggttttgga ctcctggaca cctgtgttta
     7381 acacacgcag gcagccgctg tttgcacacc tcaggaagag gggggagtca caggtttagt
     7441 gaaaaggata atcaac
//