Typing tool

Complete norovirus genomes

MK753007  GII.2
 GII.P2

Length: 7,533 | 3 CDS

ORF1: 2..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       MK753007                7533 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2016/GII.P2-GII.2/Washington0526
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK753007
VERSION     MK753007.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7533)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7533)
  AUTHORS   Barclay,L., Cannon,J.L., Tsaknaridis,L.J., Montmayeur,A.M.,
            Tatusov,R.L., Chhabra,P. and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7533
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Washington0526"
                     /isolate="Hu/US/2016/GII.P2-GII.2/Washington0526"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="08-Jun-2016"
                     /note="genotype: GII.P2-GII.2"
     gene            2..5101
                     /gene="ORF1"
     CDS             2..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47681.1"
                     /translation="MKMASNDASAAAAANSNNDNTKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVDQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDSLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIRKCQIVYGGNTYTLESDGKGKVVVERVQSTSVQINNEIAGAVHHLR
                     CARIRYYVRCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLTEEADEATMKEGC
                     PKPREEEEFIVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     2..991
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     992..2089
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2090..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6710
                     /gene="ORF2"
     CDS             5082..6710
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47682.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNTEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47683.1"
                     /translation="MAGAFMAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQVQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTAYSGRFTSTAPVRQADFQHTQSRPTSGSSVSSFATQSSRPTLTTTT
                     GSSLGTASSNSTRSTNLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgcttctgc tgccgctgct gctaacagca acaacgacaa
       61 tacaaaatct tcaagtgacg gaatgcttaa caacatggcc gtcaccctta aacgagccct
      121 tggggcccgg cccaaacagc cggccccgag ggagaaaccc ccaagacccc ctagaccacc
      181 aacaccagaa ttgatcaaaa gaatcccccc cccaccaccc aatgatgggg acgaaccaac
      241 cgtgatgttt agcactgtag gtggcgtgtc tggtctacct gagctcacaa cagttgacca
      301 accacctgaa gctaacacgg cctttagtgt gcctcccctc agccaaaggg agaataggga
      361 cgctaaggaa ccgttaactg gaaccattct ggaaatgtgg gatggggaga tttatcatta
      421 tggactgtat gtggaaagag ggcttgtgtt aggcgtgcac aagccgccgg ctgccatcag
      481 catagccaaa gtggagttaa cgcccctctc actgtactgg agacctgttt acacgcctca
      541 gtaccttata tctcccgact ccttgaggaa actccatggt gaattgtttc cctacacagc
      601 ctttgaaaac aactgttatg ctttctgctg ttgggttttg gatcttaacg attcatggct
      661 aagcaggagg atgattagta ggactactgg ctttttcagg ccctaccagg agtggaacag
      721 gaagcccctc ccaactatgg atgactcaaa attgaagaag gtcgcgaaca tcgttctgtg
      781 tgcattgtca tcactgttca ctagacccat taaggacata attggcaaac tcaaacccct
      841 caacatccta aatatcctgg cctcatgcga ctggaccttt gctggcatag tggagtcact
      901 aatcctcttg gctgaactct ttgatgtgtt ctggacaccc ccagatgtgt ctgcaatgat
      961 cgcacccctc ctcggtgact acgagctgca aggccccgaa gacatcgctg tggagctcgt
     1021 gcccgttgtt atgggtggga taggcttggt gttgggattc accaaagaga aaataggtaa
     1081 gatgctctcc tctgcagcgt caactctgag ggcatgtaaa gatcttggag cctacgggtt
     1141 ggagatccta aaactagtca tgaaatggtt tttcccaaag aaggatgagg ccaacgaact
     1201 ggctatggtt agagccattg aagacgctgt actagacctg gaagcaatcg agaacaacca
     1261 tatgaccact ctattgaaag acaagaacag ccttgcagcc tacatgaaga ccttggatat
     1321 ggaagaggaa aaagctagga aactatccac caaatcagcc tcccctgaca ttgtgggcac
     1381 cataaacgcc ctactggcta ggatcgctgc cgcacgttcc ttagttcata gggccaagga
     1441 ggagctctcc agtagaccaa gaccagtcgt tctgatgatc tctggcaaac cagggatagg
     1501 aaagacccat ctggccagag aattggcaaa gaaaattgca tcaacactca caggagacca
     1561 aagggtgggt ctcatcccac ggaatggagt tgaccattgg gacgcctaca aaggtgagag
     1621 agtggtgctc tgggatgact acggtatgag caatcccatc cacgatgcac tgaggttgca
     1681 ggaattggca gacacatgtc cactaactct gaattgtgac aggattgaaa acaaggggaa
     1741 agtcttcgac agcgacgcga tcataatcac caccaatttg gtcaatcccg cgccgctgga
     1801 ctatgtcaac tttgaggctt gctccagacg tatagacttc cttgtgtatg ctgatgcccc
     1861 agaagtcgag aaagcaaagc gggacttccc cggtcaaccg gacatgtgga aggacgccta
     1921 tcgccctgat ttctcacata ttaaattgca acttgcacca caaggtgggt ttgacaaaaa
     1981 tggcaacacc ccacatggta aaggagtgat gaagactctc actgccagtt cgctggttgc
     2041 gcgtgcctct ggtctcttgc acgagagatt agatgagtac gagttacagg gtccgcccct
     2101 ttcaaccttc aactttgacc gcaacaaaat tgcagcgttc agacaactcg ccgctgaaaa
     2161 taagtatggt ctggtggaca cgatgagggt gggcaaccag ctcaggaatg ttacgaccat
     2221 ggatgaactc aagaaggcta tcaaaaacat tataatcagg aagtgccaga tagtctatgg
     2281 cggcaacact tacacgcttg agtctgacgg caagggcaag gttgttgttg agagggtgca
     2341 gagcaccagc gtgcaaatta acaatgagat cgctggtgca gtgcatcacc ttaggtgtgc
     2401 caggataagg tactatgtca gatgtgtcca agaggccatc tactcactcc tccaaatcgc
     2461 cggcacggtg tttgtcactt cacgcatcgt aagccgcatg aatattcaaa atttatggtc
     2521 cagaccatta actgaagaag cagatgaggc aaccatgaaa gaggggtgcc ctaaacctag
     2581 ggaagaagag gagtttatcg tctcttcgga tgacatcaag ccagagggca agaaaggtaa
     2641 gaacaagagt ggccggggca agaaacacac ggcattttca agtaaaggtc tcagtgatga
     2701 ggagtatgaa gagtacaaaa ggatcagaga ggagagaaac ggcaaatact ccatagagga
     2761 atacctacag gacagagaca aatactacga agaggtggcc attgccaggg caactgaaga
     2821 agacttctgt gaagaagaag aggttaagat tcgccagagg atcttcaggc caacaagaaa
     2881 gcaacgcaag gaagaaagag ccaaccttgg cctcgtcacc ggatctgaga tcaggaagag
     2941 gaatccagat gacttcaaac caaaaggaaa gctgtgggcc gacgatgaca ggagcgtcga
     3001 ctacaacgaa agaatcagct ttgaggcccc accgagcatt tggtctagaa ttgttaactt
     3061 tggttctgga tgggggtttt gggtgtcacc cagcctcttc ataacatcaa cacatgtcat
     3121 acctcaaggc ataactgagg cctttggtgt acccataagg caggttcaaa tacacaaatc
     3181 gggcgaattc tgtcgtctga gattcccaaa acccatcagg acggatgtgt caggtatgat
     3241 actggaggag ggagcgcctg aaggcactgt tgccaccata ctcatcaaaa gaaccactgg
     3301 agagctgatg cctcttgcag caagaatggg cacccacgcg accatgagaa tacaaggacg
     3361 cacggtgggc ggccagatgg ggatgctgct tactgggtcc aacgcaaaga gcatggatct
     3421 tggcaccacg cccggtgact gtgggtgtcc ctacatttac aaaaggggca acgattacat
     3481 agtcattgga gtccacacag cagccgctcg tggcggaaac actgtcatct gcgccacaca
     3541 aggtagtgaa ggtgaggcaa cactcgaggg tggtgataat aaaggaacat actgtggggc
     3601 accaatccta ggccccggga acgccccaaa actgagcacc aaaactaagt tctggaggtc
     3661 ctcaactaca ccactcccac ccggcacgta cgagccggca tatctgggag gaaaagaccc
     3721 ccgagtcaaa ggtggaccat ctctgcaaca agttatgcga gaccaactga agccattcac
     3781 tgaaccccgt ggtaagccac caaaaccaag tgtccttgaa gctgctaaaa agacaatcat
     3841 caatgtgcta gaacaaacaa tagacccccc acaaaagtgg acgtacgcgc aagcgtgcgc
     3901 gtcccttgac aaaaccacat ctagtgggtt cccccaccac gtgcgcaaga acgagcactg
     3961 gaatggggaa tctttcacag gaaaattggc tgaccaggca tcaaaagcaa acttaatgtt
     4021 tgaagagggg aagcacatga ctccagttta cacagctgcc cttaaggatg agctggtcaa
     4081 aactgagaaa gtgtatggaa aaataaagaa gaggttgctt tggggctctg acctggccac
     4141 catggtgcgg tgcgcgcgct cctttggcgg tctgatggac gaactcaaag cccactgtgt
     4201 gacactcccg ataagggttg gcatgaacat gaatgaagat ggaccaatag tctttgaaaa
     4261 acattccaga tataggtatc actatgatgc agactattcc aggtgggact caacacagca
     4321 aagagccgtt ctggccgcgg ccatggagat catggttaaa ttctcagcag aaccacaact
     4381 agcccaaata gttgcagagg acctattgtc gcctagtgta gttgacgtgg gcgacttcaa
     4441 aatttccatc aatgaagggt tgccatcggg tgtcccttgc acctctcagt ggaattccat
     4501 cgcacattgg ctcctcactt tgtgtgccct ctctgaggtc acagacctct ctcctgacat
     4561 tgtacaggcc aactccctct tctccttcta tggagatgat gaaattgtga gcacagatat
     4621 taaattggac ccagaaaaac tgacggggaa gttgagagaa tatggtctca aacctactcg
     4681 tcctgacaaa actgagggcc ccctgattat cagtgaggat ctgaatggcc tgactttcct
     4741 gagaagaacc gtcacccgtg accctgcagg gtggtttggc aaactggacc aaagctccat
     4801 acttaggcaa ttgtattgga ccaagggccc caatcatgaa gacccctttg agtcaatgat
     4861 tccacactcc cagagaccca tacaactcat gtcactcttg ggtgaggcgg cactgcatga
     4921 accatcattt tacagcaaga tcagcaagct tgtgatatct gaattgaaag aaggtggaat
     4981 ggatttttac gtgcccaggc aagaacctat gtttaggtgg atgagattct cggatttgag
     5041 cacgtgggag ggcgatcgca atcttgctcc cagtcttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaat actgaggtca
     5161 tggctcttga acccgtggct ggtgccgctt tggcagcccc agtcactggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggtgaa tttacagtct
     5281 ccccccgtaa tgcccctggt gaagtgctac taaatctgga gttgggtcca gaattaaatc
     5341 cttatctggc acacttagca agaatgtaca acgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacctc
     5461 acttcccggt tgaaaacctt agtccacaac aaattaccat gttccctcat gtgattatag
     5521 atgtaaggac tttggaacct gttttattac cactccctga tgttagaaat aatttctttc
     5581 attacaatca gaaagatgat cccaagatga gaattgtggc tatgctttat acccccctta
     5641 gatcaaatgg ctcaggtgat gatgtgttca cagtctcctg tagggtgtta actaggccct
     5701 cccctgactt tgacttcaca tatctggtgc caccaacagt ggagtctaaa acaaaaccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc cagattccca gtgtctatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cattggacgg ggagctccaa gggacaacac aactccaggt cagtggcatt tgtgctttca
     5941 agggagaggt gaccgcccat ttgcatgata atgatcacct atacaatatc accatcacaa
     6001 acttgaatgg atcccctttt gacccctctg aggacatccc tgcccctctg ggcgtacctg
     6061 actttcaggg aagggtcttt ggtattatct cccaaaggga caaacacaat agccctggac
     6121 ataatgaacc agcaaacagg gggcacgacg ctgtggtccc tacttacaca gcacagtata
     6181 ctccaaaatt gggtcagatt caaattggca catggcagac tgacgatctc actgtcaacc
     6241 aaccagtaaa attcacccca gttggactca atgacactga acattttaac caatgggtgg
     6301 tccccagata tgctggtgcc ctaaacctca acacaaacct tgccccttct gttgccccag
     6361 tatttccagg ggagcgcctg ctctttttca gatcatacat ccccctcaag ggtggctatg
     6421 gaaatccagc cattgattgc ctactaccac aagagtgggt gcaacacttc taccaggaag
     6481 cagccccttc aatgagtgag gtggcccttg tcaggtacat caacccggac actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac ggtctcaagt aacaccagtg
     6601 ccccggtggt tgtacctgcc aatggatact tcaggtttga ctcttgggtg aaccaatttt
     6661 attctctcgc ccccatggga actggaaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttatggct ggtcttgcag gggacgtgct cagtaatggg ctcagttcac taattaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcagaaat tacagcaaaa
     6841 ttcttttaat catgacaagg aaatgttgca ggctcaggtt caagcaacta agcagctgca
     6901 agcagacatg atggctataa agcagggggt cctgaccgct ggcggctttt cccccgctga
     6961 tgcagccaga ggtgctgtga atgcgcccat gacacaagcg ctggattgga acggcacaag
     7021 gtattgggca ccaggctcca tgaggaccac agcttactct gggagattca catcaaccgc
     7081 cccagtgagg caggccgact ttcagcacac ccaaagccgg cccacgagtg gctcttctgt
     7141 gtcctccttt gccactcagt cttcaagacc aactttgacc acaaccactg ggtcctcact
     7201 tggtacagct tcatcaaatt cgactcgcag taccaacctc tcccaatcaa cagtttccag
     7261 agctacatct aggactggtg agtgggttag agaccaaaat agaaatttgg aaccctatat
     7321 gcatggtgcc ttacagacag cctttgtcac cccaccttcc agcagggcgt ctgacgggac
     7381 agtctcaacc gtcccaaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctt tttgcacacc tccgtaagag gggggagtca caagcttagt gaaaaggtga
     7501 aaatctattt agaattaatt gatcttacct ttt
//