Typing tool

Complete norovirus genomes

MK752947  GII.13
 GII.P16

Length: 7,448 | 3 CDS

ORF1: 4..5100
ORF2: 5081..6709
ORF3: 6709..7440
LOCUS       MK752947                7448 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2014/GII.P16-GII.13/Winnebago0598
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK752947
VERSION     MK752947.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7448)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7448)
  AUTHORS   Barclay,L., Cannon,J.L., Davis,T., Montmayeur,A.M., Tatusov,R.L.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7448
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Winnebago0598"
                     /isolate="Hu/US/2014/GII.P16-GII.13/Winnebago0598"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="17-Feb-2014"
                     /note="genotype: GII.P16-GII.13"
     gene            4..5100
                     /gene="ORF1"
     CDS             4..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47672.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRIAAFRQLAAENKYGLVDTMRIGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGRVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIVRRMNIQELWSKPPLGQNESEAKEEA
                     PKSEDDEFIISSKDIREEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERVTLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRSDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     4..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6709
                     /gene="ORF2"
     CDS             5081..6709
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47673.1"
                     /translation="MKMASNDAAPSNDGAASLVPEAINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNENNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANSGDNWDQNLLQLTYPSGASYDPTDEVPAPLGTQDFSGILYG
                     VLTQDNVSEGTGEAKNAKGVYISTTSGRFTPKIGTIGLHSITENVHPNQQSRFTPVGV
                     AQNENTPFQQWVLPHYAGALALNTNLAPAVAPTFPGEQLLFFRSRVPCVQGLRGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGTYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6709..7440
                     /gene="ORF3"
     CDS             6709..7440
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47674.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIEATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRAQVKSLSNSSQRTAAPSSIRSLSTQSTSLGSTS
                     SGGSSTTSSRSRTADWVQQQRALSPYMQGALQTAYVTPPSSRASSVSSVSTVPKGVLD
                     SWTPVFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaggaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaggcc
      121 ctcggggccc ggcccaaaca gcctgccccg agggacaact cacaaaagcc cccaagacca
      181 ccaactcccg agttggttaa gaggataccc cctcccccac ctaatggaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtgga atctctggcc tgcccgagct cacaacagtc
      301 cctcaaccgg atgtggccaa cacggcattc agtgtcccac cgctgagctt gagagaaaac
      361 agggaggcca aggaaccgct gacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtatgtgga gaaaggctta gtgttgggag tgcacaaacc acctgcagct
      481 ataagcatgg caaaagtgga gctgacgccg ttgtcattgt actggcgtgt agtctacacc
      541 ccccaatacc tcatctcccc tgaaactctc agaaggctca acggagaggc attcccttac
      601 actgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttaaca ggaggatggt gcaaagaaca acaggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcccac tatggatgac tccaaaatca agaaagtggc aaacatattc
      781 ctgtgttcat tgtccacgtt gttcaccaga cctataaaag acctcatagg aaaaattaag
      841 ccattaaaca tcttgaacat cctggcaacg tgtgactgga cattcgccgg aatagtggag
      901 tctctgatat tacttgctga actctttgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ctttacttgg agactacgag ttgcaagggc cagaagacct tgccgttgag
     1021 ctcgtacctg tagtaatggg agggatcggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggaaaaatgt tgtcctcagc agcatcaacg ctcagggctt gtaaagatct tggcgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga agaggccaat
     1201 gagctagcca tggtgagagc tatagaggat gctgtactgg atcttgaggc aatagaaaat
     1261 aatcacatga caactctgtt gaaagacaaa gacagcctag caacctacat gaaaacacta
     1321 gacatggagg aggaaaaagc cagaagattg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacgatca acgccctgct ggctcgtata gcagcggcta ggtcactagt ccacagggcc
     1441 aaggaggagt tatctagcag gataagacca gtggtcgtta tgatatccgg caaaccaggg
     1501 ataggcaaaa ctcatttggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcgggctcat accgagaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagcaacc ccattcatga tgctctgcgc
     1681 atacaagaat tggctgatac gtgtcccctc accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagtct ttgacagtga agtcataata atcacaacaa accttgccaa tccagctcca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg acttcctggt gtacgccgag
     1861 gcaccagaag tggaaaaggc aaaacgagac tttcctggtc aaccagatat gtggaaggac
     1921 gccttcaagt cggacttttc acacatcaag ttgcaacttg cacctcaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaaa ccctcaccac cggttccctg
     2041 atcgcccgtg catcaggttt actgcatgag aggatggatg aatttgaact ccaaggcccc
     2101 acagtcacca ccttcaattt tgaccggaac agaatcgctg ctttcagaca attggctgca
     2161 gaaaacaagt atggattggt ggacaccatg agaattggca atcaattaaa aggggtgaaa
     2221 accatggaag aactcaaaca agcaatcaag aatgtgatca tcaagaggtg ccggatcatc
     2281 tacggcggct ccacgtatga ccttgaatct gatggcaagg gtagagttct ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaacaac gagttggccg gagccctgca tcacctcaaa
     2401 catgcccgaa tcaggtacta cgtcaaatgt gtgcaagaag cagtctactc tattatacaa
     2461 atcgccggtg ctgcgtttgt caccacacgc atagtacgcc gcatgaacat acaagagctt
     2521 tggtcgaagc caccattagg ccaaaatgaa tcagaggcta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaggg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacatact gcattctcta gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gaactcgcca tcgccaaggc cacggaagaa
     2821 gacttctgtg aggaggagga gatcaaaatc cgtcagagga tcttccgtcc caccaggaag
     2881 caaaggaagg aagagagggt cacactaggg ctggtaactg gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc taaagggaaa ctgtgggctg atgacaacag aagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagtttt
     3061 ggttctggtt ggggcttctg ggtgtcacca agcctgttca taacatcaac tcatgtaatc
     3121 cctgcaggca taacagaggc atttggagtc cccatcaaac aaatccaggt ccacaaatca
     3181 ggtgaatttt gccggttcag attcccaaaa ccaattagat cagatgtgac agggatgatc
     3241 ctggaagaag gtgcgcctga gggcaccgtg gcaaccgtgc tcatcaaacg ccctaccgga
     3301 gagctcatgc cccttgcagc cagaatggga acacacgcaa ccatgaaaat tcagggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggttcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggtgattg tggctgtccc tacatctaca aaaggggcaa tgactacata
     3481 gtcattgggg tgcatacagc agcagcccgt ggtggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aagggacata ctgtggggca
     3601 cccattctag gccctggggg ggcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc ctcttccacc agggacgtat gagcctgcct acctcggtgg ccgtgacccg
     3721 cgtgttaagg gtgggccctc cttgcagcag gtaatgagag accagttgaa gccattcacc
     3781 gagcccaggg gtaaacctcc aagaccaagt gtgttggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgct
     3901 tcacttgaca aaaccacctc cagcgggcat ccccaccacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaattggca gaccaagcat caaaagcaaa tctaatgttt
     4021 gaggaaggga aacacatgac accagtgtat acagctgccc tcaaggatga gctagtcaag
     4081 actgacaaag tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgccaggtc ctttggtggg ctcatggatg aaatgaaagc acactgcata
     4201 tcactcccag tccgagttgg catgaacatg aatgaagatg gtccaataat ttttgagaag
     4261 cactccagat acaagtatca ctatgatgca gattactccc gctgggattc aacacaacag
     4321 agggcagtac tagcagcagc cttggagatc atggtcaggt tctctgcaga gccacaattg
     4381 gcacaaatag tcgctgagga tctgctggcc cccagtgtgg tagatgtagg agactttaaa
     4441 atttcaataa atgaagggct cccctctggt gtaccatgca cttctcaatg gaattccatc
     4501 gcacactggc tgctaaccct ctgcgccttg tctgaagtca ccaaactgtc ccctgacatt
     4561 gtacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgatata
     4621 aaattggacc ctgaaaagtt aaccaccaaa ttgaaggagt acggcctgaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgatcatc agtgaggatc tgaacggact cactttcctc
     4741 cggaggacgg tgactcgtga cccagctggc tggtttggaa aattggacca aagttcaata
     4801 ttgaggcaga tgtactggac tagagggcca aatcatgaag accccaatga gacaatgata
     4861 ccccactctc agagacccat acagctcatg gcactgcttg gtgaggcctc ccttcacgga
     4921 ccctcttttt acagcaaaat tagcaagttg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tcgaatgatg gtgcagctag tctcgtacca gaggccatta atgagactat
     5161 gccattggaa cccgttgctg gcgcatctat tgctgcccca gtggcgggac aaactaacat
     5221 aattgacccc tggataagaa caaattttgt gcaagcccct aatggagagt ttacagtatc
     5281 acccagaaat tcccctggag agatcctatt gaatttagag ttaggaccag atttgaatcc
     5341 ttacttggcc catctatcaa ggatgtacaa tggatatgct ggaggtgttg aggtgcaagt
     5401 gcttcttgct gggaacgcgt tcacagcagg aaagatatta tttgcagcaa tcccacccaa
     5461 ctttcctgta gatatgatta gcccagctca aattactatg cttccccatt tgattgtaga
     5521 tgttaggaca ttggaaccta ttatgatacc cttacctgat gttaggaatg tgttttatca
     5581 ttttaataat caaccccaac ctaggatgag attagtggct atgctctata ccccattgag
     5641 atctaatggt tcaggagatg atgtctttac tgtgtcttgt agagtgttga ctaggccaac
     5701 tcctgacttt gaattcattt acctagtgcc tccctctgta gagtccaaaa ctaaaccatt
     5761 cacacttcca atattgacca tttctgaact aaccaactcc cggtttccca tcccaattga
     5821 gcaactgtac acggccccaa atgagaataa tgttgtacag tgtcaaaatg gaaggtgcac
     5881 cttggatgga gagcttcagg gcaccaccca gctgctatca agtgcagttt gctcttacag
     5941 gggcaggact gtggctaaca gtggggacaa ttgggaccag aatttgctcc agctgaccta
     6001 cccaagcggt gcaagctatg accccactga tgaagtacca gcacccttgg gcacccaaga
     6061 tttcagtggg atattgtatg gggtgttaac ccaagacaat gtaagtgagg gtacagggga
     6121 ggctaaaaat gctaagggag tatacatatc caccaccagt ggaagattca ccccaaaaat
     6181 tgggacaatt ggattgcatt caataactga aaatgtgcac cccaatcagc aatcacggtt
     6241 cacccccgtt ggggtcgctc agaatgaaaa cacccccttc cagcaatggg ttctaccaca
     6301 ctacgcaggt gctcttgctc taaacaccaa tttggcaccc gctgttgccc cgactttccc
     6361 tggcgaacaa ttactgttct tcaggtcccg tgttccatgt gttcaaggtc tgcgggggca
     6421 ggatgctttc atagattgtc tcctacctca agagtgggtg aaccattttt atcaagaggc
     6481 tgctccctcc caagcagacg ttgccctcat caggtatgtc aaccctgata ctggtcgcac
     6541 gctgtttgag gccaaattgc acaggtcagg tttcattact gtatcacaca ctggtaccta
     6601 ccctcttgtg gtccccccga atggtcattt caggtttgat tcttgggtta accaattcta
     6661 ctcactcgcc cccatgggaa ctggcaatgg gcgtagaaga gttcaataat ggcaggagca
     6721 tttatagctg gtctagccgg tgacatgctg acttctgctg ttggttcact gacctctgca
     6781 ggagccaatg ccatcaatca gaaattgaat tttgactaca ataaacaact ccaaaatgca
     6841 tcctttcaac atgataagga aatgttgcag gcccaaattg aagctacaaa gaagctccaa
     6901 tcagaaatga ttgcaattaa gcatggggtt ttgaccgcgg gcggcttttc cccagctgat
     6961 gctgccagag gggcagtcaa cgccccaatg actcgagtgt tggattggtc agggacacgc
     7021 tactacgctc caaattctgt gcaaaccacc agttactctg ggcaattcac cccctcgcca
     7081 gtccatcggg cgcaggtgaa gtccctttcc aattcatctc agcggactgc agctccaagc
     7141 agtatccgca gcctgtcaac ccaatcaact tctttgggct ccacctcctc aggggggtcc
     7201 tctacaacct cctctagatc gaggacagca gactgggtgc aacaacaaag ggctcttagc
     7261 ccgtacatgc agggagccct gcagacggca tacgttacac cgccgtctag tagggcttcc
     7321 agtgtgagct ctgtctcaac agtgcccaaa ggggttttgg actcctggac acctgtgttt
     7381 aacacacgca ggcagccgct gtttgcacac ctcaggaaga ggggggagtc acaggcttag
     7441 tgaaaagg
//