Typing tool

Complete norovirus genomes

MK752941  GII.2
 GII.P16

Length: 7,509 | 3 CDS

ORF1: 2..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       MK752941                7509 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.2/BlackHawk0455
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK752941
VERSION     MK752941.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Barclay,L., Cannon,J.L., Davis,T., Montmayeur,A.M., Tatusov,R.L.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="BlackHawk0455"
                     /isolate="Hu/US/2017/GII.P16-GII.2/BlackHawk0455"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="09-Nov-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            2..5101
                     /gene="ORF1"
     CDS             2..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47654.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVERGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILFAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGRGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRIMAFRQLAAENKYGLMDTMRVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTKKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVVPAGITEAFGVPIKQIQIHKSGEFCRFRFPKSIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGSPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     2..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RdRp"
     gene            5082..6710
                     /gene="ORF2"
     CDS             5082..6710
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47655.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPIENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47656.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFTTQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRVTSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTASTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 aatgaagatg gcgtctaacg acgctaccgt tgccgttgct tgcaacaaca acaacgacaa
       61 agagaaatct tcaggtgaag gcttattcac aaatatgtct tccaccttaa agaaagccct
      121 cggggctagg cccaaacagc ctgccccgag agacaaacca caaaaacccc caagaccacc
      181 aactcccgag ttggtcaaga ggataccccc tcctccacct aatggcgaag aagaagaaga
      241 accagtcatt aggtatgagg ttaagagtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccaaccg gacgtggcca acacagcatt cagtgttcca ccactgagct tgagagaaaa
      361 cagggaggcc aaagaaccgc taacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agagaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 cataagcatg gcaagagtgg agctaacgcc gttgtcattg tactggcgtg tggtgtacac
      541 tccccagtac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaataact gctatgcctt ttgctgctgg gtgttagacc tcaatgactc
      661 gtggcttagc aggaggatgg tacaaagaac aacgggcttc ttcagacctt accaagattg
      721 gaacagaaaa cccctgccta ccatggatga ctccaaaatt aagaaggtgg caaatatatt
      781 cctatgttca ttgtccacat tattcaccag acccataaaa gacctcatag gaaaaataaa
      841 accattaaac atattgaata tcctggcaac gtgtgactgg acttttgccg gaatagtgga
      901 gtctctgata ttatttgctg aactcttcgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgcc cccttactcg gggactacga gttgcaaggg ccagaagacc tcgccgtcga
     1021 actcgtacct gtggtaatgg gggggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcttcaac actcagggct tgcaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aggaggccaa
     1201 tgagctagcc atggtgaggg ccatagagga tgctgtacta gaccttgagg caatagaaaa
     1261 taaccacatg acaaccctgt tgaaagacaa agacagcttg gcaacgtaca tgaaaacact
     1321 ggacatggag gaggagaaag ccaggaggtt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacaatc aacgccctgc tggctcgaat agcagcagcc aggtcattag tccacagggc
     1441 caaggaagag ctatctagca ggatgaggcc agtggttgtt atgatatctg gcaaaccagg
     1501 aataggcaaa actcatctgg ccagggaggt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcggactca taccacgaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagcaac cccattcatg atgctcttcg
     1681 catacaagaa ttggctgaca cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aacctcgcca atccagcccc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gattttctgg tgtacgctga
     1861 agcaccagac gtagaaaagg caaaacggga ctttcctggt cagccagata tgtggaagga
     1921 cgccttcaag ccagactttt cacacatcaa gctacagctt gcaccccagg gcggctttga
     1981 caagaatggc aacaccccac atgggagagg agtgatgaag accctcacta ctggttctct
     2041 gattgcccgt gcatcaggcc tactgcatga gaggatggat gaatttgaac tccaaggtcc
     2101 cacaatcacc accttcaatt tcgaccggaa cagaatcatg gcattcagac aattggctgc
     2161 agaaaacaag tatggattga tggataccat gagagttggc aatcaattaa aaggagtgaa
     2221 aaccatggaa gaactcaaac aagcaatcag gaatgtgacc atcaagaggt gccagatcat
     2281 ctacggtggt tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaac acctctgtac agaccaacaa cgagttggct ggggccctgc accatctcaa
     2401 acatgcccga atcaggtact atgtcaaatg tgtgcaagaa gcagtctatt ccatcataca
     2461 aattgccggc gctgcgtttg tcaccacacg cattgcacgc cgcatgaaca tacaagaact
     2521 ctggtcgaag ccacaactag atcaaaatga atcagagact aaggaagagg cccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctcc agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggagctcgcc attgccaagg ccacggaaga
     2821 agacttctgt gaagaggagg agatcaaaat ccgtcagaga attttccgtc ccaccaagaa
     2881 acaaagaaag gaagagaggg ccacattagg gctagtaaca ggttcagaaa tccgaaaaag
     2941 aaaccctgat gacttcaaac ccaaagggaa gctgtgggcc gatgacaaca ggagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagctt
     3061 tggttctggc tggggcttct gggtgtcacc aagccttttc ataacatcaa ctcatgtagt
     3121 ccccgcaggc ataacagaag catttggagt ccccatcaaa caaattcaga tccacaaatc
     3181 aggcgaattt tgccgattca gattcccaaa atcaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaactgtg ctcatcaaac gccccaccgg
     3301 agagctcatg cctcttgcag ccagaatggg aacacacgca accatgaaaa ttcaaggccg
     3361 catggttggc gggcagatgg gtatgttgct cactggatca aatgctaaag gaatggactt
     3421 gggaacaact cctggtgact gtggctgtcc ttatatctat aaaaggggca atgactatat
     3481 agtcattggg gtgcacactg cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 acccattcta ggccctgggg gttcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg ccccttccac cagggacata tgagcctgcc tacctcggtg gccgtgatcc
     3721 gcgtgttaag ggtgggcctt ccctgcagca ggtaatgaga gaccaattga agccattcac
     3781 tgaacccagg ggcaaacctc caagaccaag tgtattggaa gcagccaagc aaaccatcat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgcgc
     3901 ctcacttgac aaaaccacct ccagcgggca cccccatcac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaactggc agaccaagca tcaaaagcaa acctaatgtt
     4021 tgaggaaggg aagcacatga caccagtata cacagcagca ctcaaggacg agctagtcaa
     4081 gaccgagaaa atctatggaa agattaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgctaggt catttggtgg gctcatggac gagatgaagg cacactgcat
     4201 atcactccca gtccgagttg gcatgaatat gaatgaagat ggcccaataa tatttgaaaa
     4261 gcattccaga tacaaatatc actatgatgc agactactct cgttgggatt caacacaaca
     4321 gagggcagta ctagcagcag ccttggaaat catggtcaga ttctctgcag aaccacaatt
     4381 ggcacaaata gtcgctgagg atctgctggc tcctagtgta gtagatgtag gagactttaa
     4441 aattacaata aatgaagggc tcccttctgg tgtgccatgc acttctcaat ggaactccat
     4501 cgcacactgg ctgctaactc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tatacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggac cctgaacagt taaccgccaa attgaaggag tacggcctga aaccaacccg
     4681 cccggacaaa accgagggac ccctgattat cagtgaagat ttgaacggtc ttactttcct
     4741 ccgaagaacg gtgactcgtg acccagctgg ctggtttgga aaactggacc aaagctcaat
     4801 tttgaggcag atgtactgga ctagaggacc aaatcatgaa gaccccaatg agacaatgat
     4861 accccattcc caaagaccca tacaactcat ggcactgctt ggtgaagcct ctcttcacgg
     4921 accctctttc tacagtaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaac aatgaggtca
     5161 tggctcttga acccgtggct ggtgccgctt tggcagcccc ggtcaccggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc taatggtgaa tttacagtct
     5281 ctccccgaaa tgcccctggt gaagtgctac tgaatctaga gttgggtcca gaattaaatc
     5341 cttatctggc acatttagca agaatgtaca atgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttggc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacccc
     5461 acttcccgat tgaaaacctt agcccacagc aaatcaccat gttccctcat gtgatcatag
     5521 atgtgagaac cttggaacct gttttattac cactccctga tgttaggaat aacttcttcc
     5581 attataatca gaaagatgat cccaagatga gaattgtggc tatgctttat acccccctca
     5641 ggtccaatgg ttcaggtgat gatgtgttta cagtttcctg tagagtgttg actagacctt
     5701 cccctgactt tgatttcaca tacctggtgc caccaacagt ggagtctaaa acaaagccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc taggttccca gtgtccatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cactagacgg ggagctccaa gggacaacac aactccaagt cagtggcatt tgtgctttca
     5941 aaggtgaagt gaccgctcac ttgcatgaca atgatcatct atataatgtt accatcacaa
     6001 acttgaatgg gtcccctttt gatccctccg aggatatccc tgcccctctg ggtgtgcctg
     6061 acttccaggg aagggttttt ggtatcatct cccaaagaga caaacacaac agtcctgggc
     6121 ataatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtata
     6181 ctccaaaact gggacaaatt caaattggca cgtggcaaac tgacgacctt acagtcaacc
     6241 aaccagtcaa attcacccca gttggactca atgatactga acattttaac caatgggtgg
     6301 tccctaggta tgctggtgcc ctaaacctca atacaaacct tgccccttct gttgctccag
     6361 tatttccagg agagcgcctg ctcttcttca gatcatacat tcccctcaag ggcggttatg
     6421 gaaacccagc cattgattgc ctactaccac aagagtgggt gcaacacttc tatcaggaag
     6481 cagccccttc aatgagtgag gtggccctcg tcagatacat caacccggac actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac agtctcgagc aacaccagtg
     6601 ccccggtggt tgtgcctgcc aacggatact tcagatttga ttcttgggta aaccaatttt
     6661 attctctcgc ccccatggga actgggaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ttttgtagct ggtcttgcag gggacgtgct cagcaatggg cttagttcat taatcaatgc
     6781 aggtgctaat gcaataaatc agagggcaga atttgatttt aatcagaaat tgcaacaaaa
     6841 ttcttttaat catgataagg agatgttgca ggctcagatt caggcaacta agcagctgca
     6901 ggcagacatg atggccataa aacaaggggt cttgaccgct ggcggctttt cccctgctga
     6961 tgcagccaga ggtgctgtga acgcgcccat gacacaggcg ctggattgga atggcacaag
     7021 gtattgggca ccaaactcca tgaggaccac atcttattct ggaaaattca catcaaccgc
     7081 cccagtgagg caggctgact tccaacacac ccaaagccgg ccttcgagtg gctcctctgt
     7141 gtcttccttt accactcagt cttcaaggcc aactctgacc acaaccactg gttcctcaca
     7201 tggcacagcc tcatcaaatt caactcgcag cacaagcctc tcccaatcaa cggtctccag
     7261 agttacgtct aggactggtg agtgggttag agatcaaaat agaaatttgg aaccctacat
     7321 gcatggtgcc ttacagacag cctttgtcac cccaccttcc agcagggcat ctgacgggac
     7381 agcctcaacc gtcccgaaag gtgttttgga ctcctggaca cctgcgttta acacccgcag
     7441 gcagccgctt tttgcacacc tccgtaagag gggggagtca caagcttagt gaaaaggtga
     7501 aaatttatt
//