Typing tool

Complete norovirus genomes

MK752939  GII.2
 GII.P16

Length: 7,498 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6712
ORF3: 6712..7491
LOCUS       MK752939                7498 bp    RNA     linear   VRL 11-APR-2019
DEFINITION  Norovirus GII isolate Hu/US/2017/GII.P16-GII.2/Pierce0448
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK752939
VERSION     MK752939.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7498)
  AUTHORS   Barclay,L., Cannon,J.L., Wikswo,M.E., Phillips,A., Browne,H.,
            Montmayeur,A.M., Tatusov,R.L., Burke,R.M., Hall,A.J. and Vinje,J.
  TITLE     Emergence and characterization of multiple viruses associated with
            a novel GII.P16 polymerase in the United States, 2015-2018
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7498)
  AUTHORS   Barclay,L., Cannon,J.L., Davis,T., Montmayeur,A.M., Tatusov,R.L.
            and Vinje,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2019) Division of Viral Diseases, Centers for
            Disease Control and Prevention, 1600 Clifton Road NE, Atlanta, GA
            30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Geneious v. R10; SPAdes v. 3.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7498
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Pierce0448"
                     /isolate="Hu/US/2017/GII.P16-GII.2/Pierce0448"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="USA"
                     /collection_date="23-Aug-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBS47648.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRIAAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVSIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     4..999
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1000..2097
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2098..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6712
                     /gene="ORF2"
     CDS             5084..6712
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBS47649.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEAMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6712..7491
                     /gene="ORF3"
     CDS             6712..7491
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBS47650.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaagaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaagcc
      121 ctcggggcta ggcccaaaca gcctgccccg agagacaaac cacaaaagcc cccaagacca
      181 ccaactcccg agttggtcaa gaggataccc cctcctccac ctaacggcga agaagaagaa
      241 gagccagtca ttaggtatga ggtcaagagt gggatctctg gcctgcccga gctcacaaca
      301 gtcccccaac cggacgtggc caacacagca ttcagtgttc caccactgag cttgagagaa
      361 aacagggagg ccaaggagcc gctaacaggg gcaatattag agatgtggga tggagagata
      421 taccactatg gcctgtacgt ggagaaaggc ttagtgttgg gtgtgcacaa accacctgca
      481 gccataagca tggcaagagt ggagctgacg ccgttgtcat tgtactggcg tgtggtgtac
      541 actccccaat acctcatctc ccctgaaacc ctcaggaggc tcaacggaga ggcattccct
      601 tacaccgcct ttgacaacaa ctgctatgcc ttttgctgct gggtgttaga tctcaatgac
      661 tcatggctta gcaggaggat ggtacaaaga acaacgggct tcttcagacc ttaccaagag
      721 tggaacagaa aacccctgcc taccatggat gactccaaaa ttaagaaggt agcaaatata
      781 ttcctatgtt cattgtccac attattcacc agacccataa aagacctcat aggaaaaatt
      841 aaaccattga acatattgaa tatcctggca acgtgtgact ggacttttgc cggaatagtg
      901 gagtctctga tattacttgc tgaactcttc ggagttttct ggacaccccc agatgtgtct
      961 gctatgatcg ctcccttact cggggactac gagttgcaag ggccagaaga cctcgccgtt
     1021 gaactcgtac ctgtggtaat gggggggatt ggtttggtgt tgggattcac caaagagaaa
     1081 attggcaaaa tgttgtcctc agcagcatca acactcaggg cttgcaaaga tcttggtgcc
     1141 tatggcttag agatactcaa attggtcatg aagtggttct tcccaaagaa agaggaggcc
     1201 aatgagctag ctatggtgag ggccatagag gatgctgtac tagaccttga ggcaatagaa
     1261 aataaccaca tgacaaccct gttgaaagac aaagacagct tagcaacata catgaaaaca
     1321 ctggacatgg aggaggagaa agccaggagg ttgtccacaa aatctgcatc ccctgacata
     1381 gttgggacaa tcaacgccct gctggctcga atagcagcgg ccaggtcatt agtccacagg
     1441 gccaaggaag agctatctag taggataagg ccagtagttg ttatgatatc tggcaagcca
     1501 ggaataggca aaactcatct ggccagggag gtggcaagaa aggtggcatc cactctcaca
     1561 ggggatcaaa gagtcggact cataccacga aacggtgtgg accattggga tgcatacaaa
     1621 ggtgagagag tcgtgctgtg ggacgactat ggcatgagta accctattca tgatgctctt
     1681 cgcatacaag aattggctga tacgtgtccc cttaccttaa attgtgacag aattgaaaat
     1741 aagggaaaag tttttgacag tgaagtcata ataattacaa caaaccttgc caatccagcc
     1801 ccacttgatt atgtcaactt tgaggcctgt tccaggagaa ttgacttcct ggtgtacgct
     1861 gaggcaccag aagtagaaaa ggcaaaacgg gactttcctg gtcagccaga tatgtggaag
     1921 gacgccttca agccggactt ttcacacatc aagctacagc ttgcacccca gggcggcttt
     1981 gacaagaatg gcaacacccc acatgggaaa ggagtaatga agaccctcac taccggttct
     2041 ctgattgccc gtgcatcagg cctactgcat gagaggatgg atgaatttga actccaaggc
     2101 cccacaatca ccaccttcaa tttcgaccga aacagaatcg cggcattcag acaattagct
     2161 gcagaaaaca agtatggatt ggtggatacc atgaaagttg gcaatcagtt aaaaggagtg
     2221 aaaaccatgg aagaactcaa acaagcaatc aggaatgtga ccatcaagag gtgccagatc
     2281 atctacggtg gttccacgta tgaccttgaa tctgatggca agggcaaagt tttggtggaa
     2341 aaagtcaaga acacctctgt acagaccaat aacgagttgg ctggggccct gcaccatctc
     2401 aaacatgccc gaatcaggta ctatgtcaaa tgtgtgcaag aagcagtcta ttccatcata
     2461 caaattgccg gcgctgcgtt tgtcaccacg cgcattgcac gccgcatgaa catacaagaa
     2521 ctctggtcga agccacaact agatcaaaat gaatcagaga ctaaggaaga ggcccccaag
     2581 tcagaagatg acgagttcat catatcttct aaggacatca aggaggaagg aaagaagggc
     2641 aaaaacaaaa ctggccgtgg caagaaacac actgcattct ccagcaaggg cttgagcgat
     2701 gaggagtatg acgagtacaa gaggataaga gaagagagaa atgggaagta ctctatagag
     2761 gagtatcttc aagacagaga caggtactat gaggagctcg ccattgccaa ggccacggaa
     2821 gaagacttct gtgaagagga ggagatcaaa atccgtcaga gaattttccg tcccaccagg
     2881 aaacaaagaa aggaagagag ggccacatta gggctagtaa caggttcaga aatcagaaaa
     2941 agaaaccctg atgacttcaa acccaaaggg aagctatggg ccgatgacaa caggagtgtt
     3001 gactacaatg agaaactgga ctttgaggcc cccccaagca tatggtctag gattgtgagc
     3061 tttggctctg gctggggctt ctgggtgtca ccaagccttt tcataacatc aactcatgta
     3121 atccccgcag gcataacaga agcatttgga gtctccatca aacaaattca gatccacaaa
     3181 tcgggcgaat tttgccgatt cagattccca aaaccaatta gaccagatgt gacaggaatg
     3241 atcttggaag aaggtgcgcc tgagggcacc gtggcaactg tgctcatcaa acgccccacc
     3301 ggagagctca tgcctcttgc agccagaatg ggaacacacg caaccatgaa aattcaaggc
     3361 cgcatggttg gcggacagat gggtatgttg ctcactggat caaatgctaa aggaatggac
     3421 ttgggaacaa ctcctggtga ctgtggctgt ccttacatct ataaaagggg caatgactat
     3481 atagtcattg gggtgcacac tgcagcagcc cgtggtggaa acactgtcat ctgtgccaca
     3541 cagggaagtg agggtgaggc aactcttgag ggtggagatg acaaaggaac atactgtggg
     3601 gcacccattc taggccctgg gggtgcacca aaattgagca ccaaaaccaa attttggagg
     3661 tcatcgaaca cgcccctccc accagggaca tatgagcctg cctacctcgg tggccgtgat
     3721 ccgcgtgtta agggtgggcc ttccctgcag caggtgatga gagaccagtt gaagccattc
     3781 actgaaccca ggggcaaacc tccaagacca agtgtattgg aagcagccaa acaaaccatc
     3841 atcaatgtcc tcgaacaaac cctggaccct ccacaaaaat ggacatacgc acaggcttgt
     3901 gcctcacttg acaaaaccac ctccagcggg cacccccatc acgtccgaaa gaatgaattc
     3961 tggaatggtg agaccttcac tggtaaactg gcagaccaag catcaaaagc aaacctaatg
     4021 tttgaggaag ggaaacacat gacaccagtg tacacagcag cactcaagga cgagctagtc
     4081 aagactgaga aaatctatgg aaagatcaag aagagactgc tctggggctc tgacttgtcc
     4141 accatgatcc ggtgcgctag gtcatttggt gggcttatgg acgagatgaa ggcacactgc
     4201 atatcactcc cagtccgagt tggcatgaat atgaatgaag atggcccaat aatatttgag
     4261 aaacattcca gatacaaata tcactatgat gcagactact ctcgttggga ttcaacacaa
     4321 cagagggcag ttctagcagc agccttggaa atcatggtca gattctctgc agaaccacaa
     4381 ttggcacaaa tagtcgctga ggatctgctg gcccctagtg tagtagatgt aggagacttt
     4441 aaaattacaa taaatgaagg gctcccttct ggtgtgccat gcacttctca atggaactcc
     4501 atcgcacact ggctgctaac tctctgtgcc ttgtctgaag tcaccaaact gtcccctgac
     4561 attatacagg caaattccat gttctcattt tacggtgatg acgagattgt cagtaccgac
     4621 ataaaattgg accctgaaca gttaaccgcc aaattgaagg agtacggcct gaaaccaacc
     4681 cgcccagaca aaaccgaggg acccctgatt atcagtgaag atttgaacgg tctcactttc
     4741 ctccgaagga cggtgactcg tgacccagct ggctggtttg gaaaactgga ccaaagctca
     4801 attttgaggc agatgtactg gactagagga ccaaatcatg aagaccccaa tgagacaatg
     4861 ataccccatt cccaaagacc catacagctc atggcactgc ttggtgaagc ctctcttcac
     4921 ggaccctctt tctacagtaa aatcagtaaa ttggtcataa ctgaactcaa agaaggtggg
     4981 atggactttt acgtgccaag gcaggaaccc atgttcaggt ggatgaggtt ttctgacttg
     5041 agcacgtggg agggcgatcg caatctggct cccaattttg tgaatgaaga tggcgtcgaa
     5101 tgacgccgct ccatctactg atggtgcagc cggcctcgtg ccagaaagta acaatgaggc
     5161 catggctctt gaacccgtgg ctggtgccgc cttggcagcc ccggtcaccg gtcaaacaaa
     5221 tattatagac ccttggatta gagcaaattt tgtccaggcc cccaatggtg aatttacagt
     5281 ctctccccga aatgcccctg gtgaagtgct actgaatcta gaattgggtc cagaattaaa
     5341 tccttatctg gcacatttag caagaatgta caatgggtat gccggtggga tggaggtgca
     5401 ggtcatgttg gctgggaacg cgttcacagc cggcaagttg gtcttcgccg ccgtgccacc
     5461 ccacttcccg gttgaaaacc ttagcccaca gcaaatcacc atgttccctc atgtgatcat
     5521 agatgtgaga accttggaac ctgttttatt accactccct gatgttagga ataacttctt
     5581 ccattataac cagaaagatg atcccaagat gagaattgtg gctatgcttt atacccccct
     5641 caggtctaat ggttcaggtg atgatgtgtt tacagtctcc tgtagagtgt tgactagacc
     5701 ttcccctgac tttgacttca catacctggt gccaccaaca gtggagtcta aaacaaagcc
     5761 attcaccctc ccaatcctca cacttgggga actttccaat tctaggttcc cagtgtccat
     5821 agaccagatg tacaccagcc ccaatgaaat tatatcagtg cagtgtcaaa atggtaggtg
     5881 cacactggac ggggagctcc aagggacaac acaactccaa gtcagtggca tttgtgcttt
     5941 caaaggtgag gtgaccgccc acttgcatga caatgatcac ctatataatg tcaccatcac
     6001 aaacttgaat gggtcccctt ttgatccctc cgaggatatc cctgcccctt tgggtgtgcc
     6061 tgacttccag ggaagggttt ttggtatcat ctcccaaaga gataaacaca atagtcctgg
     6121 gcataatgaa ccagcaaaca ggggacacga cgctgtggtc cctacttaca cagcacagta
     6181 cactccaaaa cttggacaaa ttcaaattgg cacatggcaa actgacgacc ttacagtcaa
     6241 ccaaccagtc aaattcaccc cagttggact caatgacact gaacacttta accaatgggt
     6301 ggtccctagg tatgctggtg ccctaaacct caatacaaac cttgcccctt ctgttgctcc
     6361 agtatttcca ggagagcgcc tgctcttctt cagatcatac attcccctca agggcggtta
     6421 tggaaaccca gccattgatt gcttactacc acaagagtgg gtgcaacact tctatcagga
     6481 agcagcccct tcaatgagtg aggtggccct cgtcagatac atcaacccgg acactggtcg
     6541 ggcactgttt gaggccaagc tccacagagc tggtttcatg acagtctcga gcaacaccag
     6601 tgccccggtg gttgtgcctg ccaacgggta cttcagattt gattcttggg tgaaccagtt
     6661 ttattctctc gcccccatgg gaactgggaa tgggcgtaga agggttcaat aatggctgga
     6721 gcttttgtag ctggtcttgc aggggacgtg ctcagcaatg ggcttagttc attaatcaat
     6781 gcaggtgcta atgcaataaa tcagagggca gaattcgatt ttaaccaaaa attgcagcaa
     6841 aattctttta atcatgataa ggagatgttg caggctcaga ttcaggcaac taagcagctg
     6901 caggcagaca tgatggctat aaaacaaggg gtcttgaccg ctggcggctt ttcccctgct
     6961 gatgcagcca gaggtgctgt aaacgcgccc atgacacagg cgctggattg gaatggtaca
     7021 aggtattggg caccaaactc catgaggacc acatcttatt ctggaaaatt cacatcaacc
     7081 gccccagtga ggcaggctga cttccagcac acccaaagcc ggccttcgag tggctcctct
     7141 gtgtcttcct ttgccactca gtcttcaagg ccaactttga ccacaaccac tggttcctca
     7201 catggcacag cctcatcaaa ttcaactcgc agcacaagcc tctcccaatc aacggtctcc
     7261 agagctacat ctaggactgg tgagtgggtt agagatcaaa atagaaattt ggaaccctac
     7321 atgcatggtg ccttacagac agcctttgtc accccacctt ccagcagggc atctgacggg
     7381 acagtctcaa ccgtccctaa aggtgttttg gactcctgga cacctgcgtt taacacccgc
     7441 aggcagccgc tttttgcaca cctccgtaag aggggggagt cacaagctta gtgaaaag
//