Typing tool

Complete norovirus genomes

MK729086  GII.2
 GII.P2

Length: 7,496 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MK729086                7496 bp    RNA     linear   VRL 08-APR-2019
DEFINITION  Norovirus GII isolate Hu/Guangzhou/GZ2015-L335/CHN/2015
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK729086
VERSION     MK729086.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7496)
  AUTHORS   Xue,L., Gao,J., Cai,W., Zhang,L., Zuo,Y., Zhang,J. and Wu,Q.
  TITLE     Comparative molecular evolution of the major and minor capsid
            proteins VP1/VP2 in human norovirus genotype GII.2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7496)
  AUTHORS   Xue,L., Gao,J., Cai,W., Zhang,L., Zuo,Y., Zhang,J. and Wu,Q.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-APR-2019) State Key Laboratory of Applied
            Microbiology Southern China, Guangdong Institute of Microbiology,
            Xianlie Zhong Road, Guangzhou, Guangdong 510070, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7496
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/Guangzhou/GZ2015-L335/CHN/2015"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="20-Jan-2015"
                     /note="genotype: GII.P2|GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBR54579.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSNDGMLNNMAVTLKRALGARP
                     KQPVPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILFAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPSLSTFNFDRNKIAAFRQLAAENKYGLVDTMKVGNQLRNVTTM
                     DELKKAIKNIMIRKCQIVYGGNTYTLESDGKGKVVVERVQNASVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNFWSRPLTEDVDEATTKEGC
                     PKPREEEEFIVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGFPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QBR54580.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHSEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QBR54581.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQRLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGRFTSTAPARQADFQHTQSRPSSGSSVSSFATQSSRPTLATTT
                     GSSHGTASSNSTRSTNLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgttaaca gcaacaacga
       61 caacacaaaa tcttcgaatg acggaatgct taacaacatg gccgtcaccc ttaaacgagc
      121 ccttggggcc cggcccaaac agccggtccc gagggagaaa cccccaagac cccctagacc
      181 accaacacca gaattgatca aaagaatccc ccccccacca cccaatgatg gggacgaacc
      241 aaccgtgatg ttcagcactg taggtggtgt gtctggccta cctgagctta caacagttgg
      301 tcaaccacct gaagctaaca cggcctttag tgtgcctccc ctcagccaaa gggagaatag
      361 ggacgctaag gaaccgttaa ctggaaccat tctggaaatg tgggatgggg agatctatca
      421 ttatggtctg tatgtggaaa aagggcttgt gttaggcgtg cacaagccgc cggctgccat
      481 cagcatagcc aaagtggagt taacgcccct ctcactgtac tggaggcctg tttacacgcc
      541 tcagtacctt atatctcctg acaccttgag gaaactccat ggtgaattat ttccctacac
      601 agcctttgaa aacaattgtt atgccttctg ctgttgggtt ttggacctta acgattcatg
      661 gctaagcaga aggatgatta gtaggactac tggctttttc aggccctacc aagagtggaa
      721 caggaagccc ctcccaacta tggatgactc aaaattgaag aaggttgcaa acatcgttct
      781 gtgtgcattg tcatcactgt tcactagacc cattaaggac ataattggca aacttaaacc
      841 cctcaacatc ctaaacatcc tggcttcatg cgactggacc tttgctggca tagtagagtc
      901 actaatcctc tttgctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcacct ctcctcggtg actacgagct gcaaggcccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gttatgggtg ggataggctt ggtgttggga ttcaccaaag agaaaatagg
     1081 caagatgctc tcctctgcag cgtcaactct gagggcttgt aaagatcttg gagcctacgg
     1141 attggagatc ctgaaactag tcatgaaatg gtttttccca aagaaggatg aggccaatga
     1201 actggctatg gttagagcca ttgaagacgc tgtgttagac ttggaggcca ttgagaacaa
     1261 ccacatgacc actctattga aagacaagaa cagccttgca gcctacatga agaccctgga
     1321 catggaagag gaaaaagcta gaaagctatc caccaaatca gcctcccccg acattgtggg
     1381 caccataaac gccctgctgg ctaggatcgc tgccgcacgt tccttggttc atagggccaa
     1441 ggaagagctc tccagcagac caaggccagt cgtcctgatg atctccggca aaccagggat
     1501 aggaaagacc catttggcca gagaactggc aaagaaaatt gcctcaacac tcacaggaga
     1561 ccaaagggtg ggcctcatcc cacggaatgg agttgaccat tgggacgcct acaaaggaga
     1621 gagagtggtg ctctgggatg actatgggat gagcaacccc attcacgatg cgctgaggtt
     1681 gcaggaattg gcagacacat gtccactaac tctgaattgt gacaggattg aaaacaaggg
     1741 gaaagtcttc gacagcgacg caatcataat caccaccaat ttggtcaatc ccgcgccgct
     1801 ggattatgtc aactttgaag cctgctccag acgtatagac ttccttgtgt atgctgatgc
     1861 cccagaagtc gagaaagcaa agcgggactt ccccggtcaa ccggacatgt ggaaggacgc
     1921 ctatcgccct gacttctcac atattaaatt gcaacttgca ccacaaggtg ggttcgacaa
     1981 gaatggcaac accccacatg gtaaaggagt aatgaagact ctcactgcca gttcactggt
     2041 tgcgcgtgcc tctggtctct tgcatgagag attagatgag tacgagttac agggtccgtc
     2101 cctttcaacc ttcaactttg accgcaacaa aattgcagcg ttcagacaac tcgccgccga
     2161 aaacaagtat ggtctagtgg acacgatgaa ggtgggcaac cagctcagaa atgtcacgac
     2221 catggatgag cttaagaagg ctatcaaaaa catcatgatc aggaagtgcc agatagtcta
     2281 tggtggcaac acttacacgc ttgaatctga tggcaagggt aaggttgtag ttgagagggt
     2341 gcagaacgcc agcgtgcaaa tcaacaatga gatcgctggt gcagtacatc accttagatg
     2401 tgccaggata aggtattatg tcaagtgtgt ccaagaggcc atctactcac tcctccaaat
     2461 cgccggcacg gtgtttgtca cttcacgcat cgtaagccgc atgaacatcc aaaatttttg
     2521 gtccagacca ttaactgaag atgtagatga ggccaccacg aaagaggggt gccctaaacc
     2581 tagggaagaa gaggagttta tcgtctcttc agatgatatc aagccagagg gcaagaaagg
     2641 taaaaacaag agtggccggg gcaagaaaca cacggcattc tcaagtaaag gtctcagtga
     2701 tgaggaatat gaagagtaca agaggatcag agaggagagg aatggcaagt actccataga
     2761 ggaataccta caggacagag acaaatacta tgaagaggtg gccattgcca gggcaactga
     2821 agaagatttc tgcgaagaag aagaggttaa gattcgtcag aggatcttca ggccaacaag
     2881 aaaacaacgc aaggaagaaa gagccaacct tggcctcgtc accggatctg agatcaggaa
     2941 aaggaaccca gatgacttca aaccaaaagg gaagttgtgg gccgacgatg acaggagcgt
     3001 cgactacaat gaaagaatca gctttgaggc cccaccaagc atttggtcta gaattgtcaa
     3061 ctttggttct ggatgggggt tttgggtgtc gcccagtctt ttcataacat caacacatgt
     3121 cataccccaa ggcataactg aggcctttgg tgtacccata aggcaggtgc aaatacacaa
     3181 atcgggcgaa ttctgtcgac tgagattccc aaaacccatc aggacagatg tatcaggtat
     3241 gatactggag gagggagcgc ctgaaggcac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctctcg cagcaagaat gggcacccac gcgactatga gaatacaagg
     3361 gcgcacagtg ggcggccaga tggggatgct gcttactggg tccaacgcaa agagcatgga
     3421 tcttggcacc acgcccggtg actgtgggtg cccctacatt tacaaaaggg gcaatgacta
     3481 catagtcatt ggagttcaca cagcagccgc tcgtggcgga aacacagtca tctgcgccac
     3541 gcaaggcagt gaaggtgagg ccacactcga gggtggtgac aataaaggaa catactgcgg
     3601 ggcaccaatc ctaggccccg ggaatgcccc aaagctgagc actaaaacca agttctggag
     3661 gtcctccaca acaccactcc cacccggcac gtatgagccg gcatatctgg gaggaaaaga
     3721 cccccgagtc aaaggtggac catctctgca acaagttatg cgagaccaac tgaaaccatt
     3781 cactgaaccc cgtggtaagc caccaaaacc aagtgtcctt gaagctgcta aaaagacaat
     3841 tatcaatgtg ctagaacaaa caatagatcc cccacaaaaa tggacgtacg cacaagcgtg
     3901 cgcgtctctc gacaaaacca catctagtgg gttcccccac cacgtgcgca aaaacgagca
     3961 ctggaatggg gaatctttca caggaaaatt ggctgaccag gcgtcaaaag caaacctaat
     4021 gtttgaagag gggaagcaca tgaccccagt ttacacagct gcccttaagg atgagctggt
     4081 caaaactgag aaagtgtatg ggaaaataaa gaagaggttg ctttggggct ctgatctggc
     4141 caccatggtg cggtgcgcac gctcctttgg cggtttgatg gacgagctca aggcccactg
     4201 tgtgacactt ccgataaggg ttggcatgaa catgaatgaa gatggaccaa taatctttga
     4261 gaaacactcc agatataggt accactatga tgcagactat tccaggtggg attcaacaca
     4321 gcagagagcc gttctggccg cggccatgga gattatggtt aaattctcag cagaaccaca
     4381 actagcccaa atagttgcag aggatctatt gtcgcctagt gtagttgacg tgggcgactt
     4441 caaaatttcc atcaatgaag ggttgccatc gggtgtcccc tgcacctctc aatggaactc
     4501 catcgcacat tggctcctta ctttgtgtgc cctttctgaa gttacagacc tctctcctga
     4561 cattgtacag gccaactccc tcttctcctt ctatggagat gatgaaattg tgagcacaga
     4621 tattaaatta gatccagaaa agctgacggg gaagttgaga gaatatggtc tcaaacctac
     4681 tcgtcctgac aaaactgagg gccccctgat cattagtgag gatctgaatg gcctgacttt
     4741 cctgaggaga accgtcaccc gcgaccctgc ggggtggttt ggcaaactgg accaaagctc
     4801 catacttagg caattgtatt ggaccaaagg ccccaatcat gaagacccct ttgagtcaat
     4861 gattccacac tcccagagac ccatacaact catgtcactt ttgggcgagg cagcactgca
     4921 tgaaccatca ttttacagca agatcagcaa gcttgtaata tccgaattga aagaaggtgg
     4981 aatggatttt tacgtgccca ggcaagaacc tatgtttagg tggatgaggt tctcggattt
     5041 gagcacgtgg gagggcgatc gcaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgaacccgtg gctggtgccg ctttggcagc ccctgtcact ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tttctccccg taatgcccct ggtgaagtgc tactgaatct ggagttgggt ccagaattaa
     5341 atccttatct ggcacactta gcaagaatgt acaacgggta cgccggtggg atggaggtgc
     5401 aggtcatgct ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gccgtgccac
     5461 ctcacttccc ggttgaaaac cttagcccac aacaaattac catgttccct catgtgatta
     5521 tagatgtaag gactttggaa cctgttttat taccactccc tgatgttaga aataatttct
     5581 tccattacaa tcagaaagat gaccccaaga tgagaattgt ggctatgctt tatacccccc
     5641 ttaggtctaa tggctcaggt gatgatgtgt ttacagtctc ctgtagggtg ttaactagac
     5701 cctctcctga tttcgacttc acatatctgg tgccaccaac agtggagtct aaaacaaaac
     5761 cattcaccct cccaatcctc acacttgggg aactttccaa ttctagattc ccagtgtcta
     5821 tagaccagat gtacaccagc cctaatgaag ttatatcagt gcagtgtcaa aatggtaggt
     5881 gcacattgga cggggagctc caaggaacaa cacaacttca agtcagtggc atttgtgctt
     5941 tcaaggggga agtgaccgct cacttgcatg ataatgatca cctatacaat gtcaccatca
     6001 caaatttgaa tggatcccct tttgatccct ctgaggacat ccctgctcct ctgggcgtac
     6061 ctgacttcca gggaagggtt tttggtatta tctcccaaag agacaaacac aatagccctg
     6121 gacatagtga accagcaaac aggggacacg atgctgtggt ccccacttac acagcacagt
     6181 acactccaaa attgggtcag attcaaattg gcacatggca gaccgacgat ctcactgtca
     6241 accaaccagt caaattcact ccagttggac tcaatgacac tgaacatttc aaccaatggg
     6301 tggtccccag atatgctggt gccctaaacc tcaatacaaa tcttgcccct tctgttgctc
     6361 cagtgtttcc aggggagcgc ctactctttt tcagatcata catccctctc aagggtggtt
     6421 atggaaaccc agccattgat tgcctactac cacaggagtg ggtgcaacac ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc ttgtcagata catcaacccg gacactggtc
     6541 gggcactgtt tgaggccaag ctccacagag ctggtttcat gacagtctca agtaacacca
     6601 gtgccccggt ggttgtgcct gccaatgggt acttcagatt tgattcttgg gtgaaccaat
     6661 tctattctct cgcccccatg ggaactggaa atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggctcagtt cattaattaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga gattacagca
     6841 aaattctttc aatcatgata aggagatgtt gcaggctcag attcaggcaa ctaagcagct
     6901 acaagcagac atgatggcta taaagcaggg ggtcctgacc gctggcggct tttcccctgc
     6961 tgatgcagcc agaggtgctg tgaatgcgcc catgacacag gcgctggatt ggaacggcac
     7021 aaggtattgg gcaccaggct ccatgaggac cacatcttac tctgggagat tcacatcaac
     7081 cgctccagcg aggcaggccg acttccagca cacccaaagc cggccttcga gtggctcttc
     7141 tgtgtcctcc tttgccactc agtcttcaag gccaactttg gccacaacca ctgggtcctc
     7201 acatggcaca gcttcatcaa attcgactcg cagtactaac ctctcccagt caacagtttc
     7261 tagagccaca tctagaactg gtgaatgggt tagagaccaa aatagaaatt tggaacccta
     7321 tatgcatggt gccttacaga cagcctttgt caccccacct tccagtaggg cgtctgacgg
     7381 gacagtctca accgtcccaa aaggtgtttt ggactcctgg acacctgcgt ttaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaa
//