Typing tool

Complete norovirus genomes

MK614137  GII.2
 GII.P16

Length: 7,536 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6709
ORF3: 6709..7488
LOCUS       MK614137                7536 bp    RNA     linear   VRL 28-APR-2019
DEFINITION  Norovirus GII isolate SZ2018139 nonstructural polyprotein (ORF1),
            VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MK614137
VERSION     MK614137.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Norovirus GII.P16/GII.2 Strain in Shenzhen, China:A Retrospective
            Study
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-2019) Department of Epidemiology, School of
            Public Health, Southern Medical University, 1023 Shatai South
            Street, Guangzhou, Guangdong 510515, China
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="SZ2018139"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="May-2018"
                     /note="genotype: GII.P16-GII.2"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QCE20842.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILFAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMLSGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSEVIVITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERTDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQITGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTVINVLEQTLDPPQKWTYTQACTSLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLQRTVTRDPPGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKVSKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6709
                     /gene="ORF2"
     CDS             5081..6709
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QCE20843.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFEFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6709..7488
                     /gene="ORF3"
     CDS             6709..7488
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCE20844.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaaa
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaggcca aggagccgct aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gctgacgccg ttgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaaccctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt acaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta agaaggtggc aaatatattc
      781 ctatgttcat tgtccacatt attcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattgaaca tattgaatat cctggcaacg tgtgactgga cttttgccgg aatagtggag
      901 tctctgatat tatttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg ggggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcta tggtgagggc catagaggat gctgtactag accttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc caggaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaagaagagc tatctagcag gataaggcca gtagttgtta tgttatctgg caaaccagga
     1501 ataggcaaaa ctcatctggc cagggaagtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accacgaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagtaacc ctattcatga tgctcttcgc
     1681 ttacaagaat tggctgatac gtgtcccctt accttaaatt gtgacagaat cgaaaataag
     1741 ggaaaagttt ttgacagtga agtcatagta attacaacaa accttgccaa cccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg atttcctggt gtacgctgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc agccagatat gtggaaggac
     1921 gctttcaagc cggacttttc acacatcaag ctacagcttg caccccaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgtg catcaggcct actgcatgag aggacggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacgg cattcagaca attggctgca
     2161 gaaaacaagt atggattggt ggataccatg aaagttggca accaattaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcaga aatgtgacca tcaagaggtg ccagatcatc
     2281 tacggtggtt ccacgtatga ccttgaatct gacggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtgca gaccaataac gagttggctg gggctctgca ccatctcaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctactc catcatacaa
     2461 attaccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaactaga tcaaaacgaa tcagagacta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcattat atcttccaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacacc gcattctcca gcaagggctt gagcgacgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg gaaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga gatcaaaatc cgtcagagga ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag gagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtgtcacca agccttttca taacatcaac tcatgtgatc
     3121 cccgcaggca taacagaagc atttggagtc cccatcaaac aaattcaggt ccacaaatca
     3181 ggcgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac agggatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccctaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggatcaa atgctaaagg gatggacttg
     3421 ggaacaactc ctggtgattg cggctgtcct tacatctaca aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ctgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggagatca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggtgg ccgtgatccg
     3721 cgtgttaagg gtgggccttc cctgcagcag gtaatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtattggaag cagccaaaca aaccgtcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacacaca ggcgtgtacc
     3901 tcacttgaca aaaccacctc cagcgggcac ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaactggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacatatgac accagtgtac acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg cttatggacg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat acaaatacca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtac tagcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgctgagga tctgctagcc cctagtgtag tagatgtagg agactttaaa
     4441 attacaataa atgaagggct cccctctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgatatt
     4561 atacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctaaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgattatc agtgaagatt tgaacggtct caccttcctc
     4741 caaaggacgg tgacacgtga cccacctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaagt cagcaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aatttcgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctactgatg gtgcagccgg cctcgtgcca gaaagtaaca atgaggtcat
     5161 ggctcttgaa cccgtggctg gtgccgcctt ggcagctccg gtcaccggtc aaacaaatat
     5221 tatagaccct tggattagag caaattttgt ccaggccccc aatggtgaat tcacagtctc
     5281 tccccggaat gcccctggtg aagtgctact gaatctagag ttgggtccag aattaaatcc
     5341 ttatctggca catttagcaa gaatgtacaa tgggtatgcc ggtgggatgg aggtgcaggt
     5401 catgttggct gggaacgcgt tcacagctgg caagttggtc ttcgccgccg tgccacccca
     5461 cttcccggtt gaaaacctta gcccacagca aattaccatg ttccctcatg tgatcataga
     5521 tgtgagaacc ctggaacctg ttttattacc actccctgat gttaggaaca acttcttcca
     5581 ttataaccag aaagatgatc ccaagatgag aattgtggct atgctttata cccccctcag
     5641 gtctaatggt tcaggtgatg atgtgtttac agtctcctgt agagtgttga ctaggccttc
     5701 ccctgacttt gaattcacat acctggtgcc accaacagtg gagtctaaaa caaagccatt
     5761 caccctccca atcctcacac ttggggaact ttccaattct aggttcccag tgtccataga
     5821 ccagatgtac accagcccta atgaaattat atcagtgcag tgtcaaaatg gtaggtgcac
     5881 actggacggg gagctccaag ggacaacaca actccaagtc agtggcattt gtgctttcaa
     5941 aggtgaagtg accgcccact tgcatgacaa tgatcaccta tataatgtca ccatcacaaa
     6001 cttgaatggg tctccttttg atccctccga ggatatccct gcccctctgg gtgtgcctga
     6061 cttccaggga agggtttttg gtatcatctc ccagagagac aaacacaata gtcctgggca
     6121 taatgaacca gcaaacaggg gacacgacgc tgtggtccct acttacacag cacagtacac
     6181 tccaaaactt ggacaaattc aaattggcac atggcaaact gacgacctta cagtcaacca
     6241 accagtcaaa ttcaccccag ttggactcaa tgacactgaa cactttaacc aatgggtggt
     6301 ccctaggtat gctggtgccc taaacctcaa tacaaacctt gccccttctg ttgctccagt
     6361 atttccagga gagcgcctgc tcttcttcag atcatacatt cccctcaagg gcggttatgg
     6421 aaatccagcc attgattgcc tactaccaca agagtgggtg caacacttct atcaggaagc
     6481 agccccttca atgagtgagg tggccctcgt cagatacatc aacccggaca ctggtcgggc
     6541 actgtttgag gccaagctcc acagagctgg tttcatgacg gtctcgagca acaccagtgc
     6601 cccggtggtt gtgcctgcca acgggtactt cagatttgat tcttgggtga accaatttta
     6661 ttctctcgcc cccatgggaa ctgggaatgg gcgcagaagg gttcaataat ggctggagct
     6721 tttgtagctg gtcttgcagg agacgtgctc agcaatgggc tcagttcatt aatcaatgca
     6781 ggtgctaatg caataaatca gagggcagaa tttgatttta atcagaaatt gcagcaaaat
     6841 tcttttaatc atgataagga gatgttgcag gctcagattc aggcaactaa gcagctgcag
     6901 gcagacatga tggctataaa acaaggggtc ttgaccgctg gcggtttttc ccctgctgat
     6961 gcagccagag gtgctgtgaa cgcgcccatg acacaggcgc tggattggaa tggcacaagg
     7021 tattgggcac caaactccat gaggaccaca tcttattctg gaaaattcac atcaaccgcc
     7081 ccagtgaggc aggctgactt ccagcacacc caaagccggc cttcgagtgg ctcctctgtg
     7141 tcttccttcg ccactcagtc ttcaaggcca actctgacca caaccactgg ttcttcacat
     7201 ggcacagcct catcaaattc aactcgcagc acaagcctct cccaatcaac ggtctccagg
     7261 gctacatcta ggactggtga gtgggttaga gatcaaaata gaaatttgga accctacatg
     7321 catggtgcct tacagacagc ctttgtcacc ccaccttcca gcagggcatc tgacgggaca
     7381 gtctcaaccg tccctaaagg tgttttggac tcctggacac ctgcgtttaa cacccgcagg
     7441 cagccgcttt ttgcacacct ccgtaagagg ggggagtcac aagcttagtg aaaaggtgaa
     7501 aatttgttta ggatgaattg attttacctt ttaaaa
//