Typing tool

Complete norovirus genomes

MK614136  GII.2
 GII.P16

Length: 7,536 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6709
ORF3: 6709..7488
LOCUS       MK614136                7536 bp    RNA     linear   VRL 28-APR-2019
DEFINITION  Norovirus GII isolate SZ2018122 nonstructural polyprotein (ORF1),
            VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MK614136
VERSION     MK614136.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Norovirus GII.P16/GII.2 Strain in Shenzhen, China:A Retrospective
            Study
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-2019) Department of Epidemiology, School of
            Public Health, Southern Medical University, 1023 Shatai South
            Street, Guangzhou, Guangdong 510515, China
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="SZ2018122"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="Apr-2018"
                     /note="genotype: GII.P16-GII.2"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QCE20839.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMIQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDTFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAFYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNELETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQTVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6709
                     /gene="ORF2"
     CDS             5081..6709
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QCE20840.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEIISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6709..7488
                     /gene="ORF3"
     CDS             6709..7488
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCE20841.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaaa
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cccccaccta acggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt caagagtggg atctctggcc tacccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgagctt gagagaaaac
      361 agggaggcca aggagccgct aacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caaaagtgga gctgacgccg ttgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaaccctc aggaggctca acggagaggc gttcccttac
      601 accgcctttg acaacaactg ctatgctttt tgctgctggg tgttagacct taatgactca
      661 tggcttagca ggaggatgat acaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta agaaggtagc aaatatattc
      781 ctatgttcat tgtccacatt attcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattgaaca tattgaatat cctggcaacg tgtgactgga cttttgccgg agtagtggag
      901 tctctgatat tacttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 cttgtgcccg tggtaatggg ggggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcta tggtgagggc catagaggat gctgtattag accttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc caggaggttg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaggaagagc tatctagtag gataaggcca gtagttgtta tgatatctgg caagccagga
     1501 ataggcaaaa ctcatctggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accacgaaac ggtgtggacc attgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagtaacc ctattcatga tgctcttcgc
     1681 atacaagaat tggctgatac gtgtcccctt accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagttt ttgacagtga agtcataata attacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg atttcttggt gtacgccgag
     1861 gcaccagaag tagaaaaggc aaaacgggac tttcctggtc agccagatat gtggaaggac
     1921 accttcaagc cggacttttc acacatcaag ctacaacttg caccccaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctctg
     2041 attgcccgtg catcaggcct actgcatgag aggatggatg aatttgaact tcaaggcccc
     2101 acaatcacca cctttaattt cgaccgaaac agaatcacgg cattcagaca gttggctgca
     2161 gaaaacaagt atggattggt ggataccatg aaagttggca atcaattaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccagatcatc
     2281 tacggtggtt ccacgtatga ccttgaatct gatggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaataac gagttggctg gggccctgca ccatcttaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cattctattc catcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc atcgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaactaga tcaaaatgaa ttagagacta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag aataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttctgtg aagaggagga gatcaaaatc cgtcagagaa ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc caaagggaag ctgtgggccg atgacaacag gagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggctctggct ggggcttctg ggtgtcacca agccttttca taacatcaac tcatgtaatc
     3121 cccgcaggca taacagaagc atttggagtc cccatcaaac aaattcagat ccacaaatca
     3181 ggcgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggatcaa atgctaaagg aatggacttg
     3421 ggaacaactc ctggtgactg tggctgtcct tacatctata aaaggggcaa tgactatata
     3481 gtcattgggg tgcacactgc agcagcccgt ggtggaaaca ctgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc cccttccacc agggacatat gagcctgcct acctcggtgg ccgtgatccg
     3721 cgtgttaagg gtgggccttc cctgcagcag gtgatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtattggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgcgcc
     3901 tcacttgaca aaaccacctc cagtgggcac ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaactggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtac acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tttatggaaa gatcaagaag agactgctct ggggctctga cttgtccacc
     4141 atgatccggt gcgctaggtc atttggtggg cttatggacg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccagat ataaatatca ttatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagttc tagcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaacag tcgctgagga tctgctggcc cctagtgtag tagatgtagg agactttaaa
     4441 atcacaataa atgaagggct cccttctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggc tgctaactct ctgtgccttg tctgaagtca ccaaactatc ccctgacatt
     4561 atacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag taccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgaaggagt acggcctgaa accaacccgc
     4681 ccagacaaaa ccgagggacc cctgattatc agtgaagatt taaacggtct cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaatt
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgagg accccaatga gacaatgata
     4861 ccccattccc aaagacccat acagctcatg gcactgcttg gtgaagcctc tcttcacgga
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctactgatg gtgcagccgg cctcgtgcca gaaagtaaca atgaggtcat
     5161 ggctcttgaa cccgtggctg gtgccgcctt ggcagccccg gtcaccggtc aaacaaatat
     5221 tatagaccct tggattagag caaattttgt ccaggccccc aatggtgaat ttacagtctc
     5281 tccccgaaat gcccctggtg aagtgctact gaatctagag ttgggtccag aattaaatcc
     5341 ttatctggca catttagcaa gaatgtacaa tgggtatgcc ggtgggatgg aggtgcaggt
     5401 catgttggct gggaacgcgt tcacagccgg caagttggtc ttcgccgccg tgccacccca
     5461 cttcccggtt gaaaacctta gcccacagca aatcaccatg ttccctcatg tgatcataga
     5521 tgtaagaacc ttggaacctg ttttattacc actccctgat gttaggaata acttcttcca
     5581 ttataatcag aaagatgatc ccaagatgag aattgtggct atgctttata cccccctcag
     5641 gtctaatggt tcaggtgatg atgtgtttac agtctcctgt agggtgttga ctagaccttc
     5701 ccctgacttt gacttcacat acctggtgcc accaacagtg gagtctaaaa caaagccatt
     5761 caccctccca atcctcacac ttggggaact ttccaattct aggttcccag tgtccataga
     5821 ccagatgtac accagcccta atgaaattat atcagtgcag tgtcaaaatg gtaggtgcac
     5881 attggacggg gagctccaag ggacaacaca actccaagtc agtggcattt gtgctttcaa
     5941 aggtgaagtg accgcccact tgcatgacaa tgatcaccta tataatgtca ccatcacaaa
     6001 cttgaatggg tccccttttg atccctccga ggatatccct gcccctttgg gtgtgcctga
     6061 cttccaggga agggtttttg gtatcatctc ccaaagagat aaacacaata gtcctgggca
     6121 taatgaacca gcaaacaggg gacacgacgc tgtggtccct acttacacag cacagtacac
     6181 tccaaaactt ggacaaattc aaattggcac atggcaaact gacgacctta cagtcaacca
     6241 gccagtcaaa ttcaccccag ttggactcaa tgacactgaa cactttaacc aatgggtggt
     6301 ccctaggtat gctggtgctc taaacctcaa tacaaacctt gccccttctg ttgctccagt
     6361 atttccagga gagcgcctgc tcttcttcag atcatacatt cccctcaagg gcggttatgg
     6421 aaacccagcc attgattgcc tattaccaca agagtgggtg cagcacttct atcaggaagc
     6481 agccccttca atgagtgagg tggccctcgt cagatacatc aacccggaca ctggtcgggc
     6541 actgtttgag gccaagctcc acagagctgg tttcatgaca gtctcgagca acaccagtgc
     6601 cccggtggtt gtgcctgcca acgggtactt cagatttgat tcttgggtga accaatttta
     6661 ctctctcgcc cccatgggaa ctgggaatgg gcgtagaagg gttcaataat ggctggagct
     6721 tttgtagctg gtcttgcagg ggacgtgctc agcaatgggc ttagttcatt aatcaatgca
     6781 ggtgctaatg caataaatca gagggcagaa tttgatttta atcaaaaatt gcagcaaaat
     6841 tcttttaatc atgataagga gatgttgcag gctcagattc aggcaactaa gcagctgcag
     6901 gcagacatga tggctataaa acaaggggtc ttgaccgctg gcggcttttc acctgctgat
     6961 gcagccagag gtgctgtgaa cgcgcccatg acacaggcgc tggattggaa tggcacaagg
     7021 tattgggcac caaactccat gaggaccaca tcttattctg gaaaattcac atcaaccgcc
     7081 ccagtgaggc aggctgactt ccagcacacc caaagccggc cttcgagtgg ctcctctgtg
     7141 tcttcctttg ccactcagtc ttcaaggcca actctgacca caaccactgg ttcctcacat
     7201 ggcacagcct cctcaaattc aactcgcagc acaagcctct cccaatcaac ggtctccaga
     7261 gctacatcta ggactggtga gtgggttaga gatcaaaata gaaatttgga accctacatg
     7321 catggtgcct tacagacagc ctttgtcacc ccaccttcca gcagggcatc tgacgggaca
     7381 gtctcaaccg tccctaaagg tgttttggac tcctggacac ctgcgttcaa cacccgcagg
     7441 cagccgcttt ttgcacacct ccgtaagagg ggggagtcac aagcttagtg aaaaggtgaa
     7501 aatttatttg ggattaattg attttacctt ttaaaa
//