Typing tool

Complete norovirus genomes

MK614125  GII.2
 GII.P16

Length: 7,536 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6709
ORF3: 6709..7488
LOCUS       MK614125                7536 bp    RNA     linear   VRL 28-APR-2019
DEFINITION  Norovirus GII isolate SZ2017203 nonstructural polyprotein (ORF1),
            VP1 (ORF2), and VP2 (ORF3) genes, complete cds.
ACCESSION   MK614125
VERSION     MK614125.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Norovirus GII.P16/GII.2 Strain in Shenzhen, China:A Retrospective
            Study
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Wang,J., Jin,M., Zhang,H., Zhu,Y., Yang,H., Yao,X., Chen,L.,
            Meng,J., Han,M., Guan,X., Hu,G., He,Y. and Duan,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-2019) Department of Epidemiology, School of
            Public Health, Southern Medical University, 1023 Shatai South
            Street, Guangzhou, Guangdong 510515, China
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="SZ2017203"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China"
                     /collection_date="Mar-2017"
                     /note="genotype: GII.P16-GII.2"
     gene            1..5100
                     /gene="ORF1"
     CDS             1..5100
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QCE20806.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLILRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKEVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILFAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCQIIYGGSTYDLESDGKGKILVEKVKNTSIQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIAIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQNWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSMWEGDRNLAPNFVNEDGVE"
     mat_peptide     1..996
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     997..2094
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2095..2625
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2626..3024
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3025..3567
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3568..5097
                     /gene="ORF1"
                     /product="RdRp"
     gene            5081..6709
                     /gene="ORF2"
     CDS             5081..6709
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QCE20807.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLPVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQERVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6709..7488
                     /gene="ORF3"
     CDS             6709..7488
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCE20808.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPNSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GPSHGTASSNSTRSTSLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctaccgtt gccgttgctt gcaacaacaa caacgacaaa
       61 gaaaaatctt caggtgaagg cttattcaca aatatgtctt ccaccttaaa gaaagccctc
      121 ggggctaggc ccaaacagcc tgccccgaga gacaaaccac aaaagccccc aagaccacca
      181 actcccgagt tggtcaagag gataccccct cctccaccta atggcgaaga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacagcattc agtgttccac cactgatctt gagagaaaac
      361 agggaggcca aggaaccgtt aacgggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caagagtgga gctgacgccg ctgtcattgt actggcgtgt ggtgtacact
      541 ccccaatacc tcatctcccc tgaaactctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tgttagacct caatgactca
      661 tggcttagca ggaggatggt acaaagaaca acgggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac catggatgac tccaaaatta aggaggtagc aaatatattc
      781 ctatgctcat tgtccacatt attcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattaaaca tattgaatat cctggcaacg tgtgactgga cttttgccgg aatagtggag
      901 tctctgatat tatttgctga actcttcgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttactcgg ggactacgag ttgcaagggc cagaagacct cgccgttgaa
     1021 ctcgtacctg tggtaatggg ggggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaaca ctcagggctt gcaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga ggaggccaat
     1201 gagctagcca tggtgagggc catagaggat gctgtactag atcttgaggc aatagaaaat
     1261 aaccacatga caaccctgtt gaaagacaaa gacagcttag caacatacat gaaaacactg
     1321 gacatggagg aggagaaagc caggaggttg tccacaaaat ctgcatcccc tgatatagtt
     1381 gggacaatca acgccctgct ggctcgaata gcagcggcca ggtcattagt ccacagggcc
     1441 aaggaagagc tatctagcag gataagacca gtggttgtta tgatatctgg caaaccagga
     1501 ataggcaaaa ctcatctggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcggactcat accgcgaaac ggtgtggacc attgggatgc atacaaaggc
     1621 gagagagtcg tgctgtggga cgattatggc atgagtaacc ccattcatga tgctcttcgc
     1681 atacaagaat tggctgacac gtgtcccctt accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagttt ttgacagtga agtcataata attacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg atttcctggt gtacgctgag
     1861 gcaccagaag tggaaaaggc aaaacgggac tttcctggtc agccagacat gtggaaggac
     1921 gccttcaagc cggacttttc acacatcaag ctacagcttg caccccaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcactac cggttctttg
     2041 attgcccgtg catcaggcct actgcatgag aggatggatg aatttgaact ccaaggtccc
     2101 acaatcacca ccttcaattt cgaccggaac agaatcacag cattcagaca attggctgca
     2161 gaaaacaagt atggattggt ggataccatg aaagttggca atcaattaaa aggagtgaaa
     2221 accatggaag aactcaaaca agcaatcagg aatgtgacca tcaagaggtg ccagatcatc
     2281 tacggtggtt ccacgtatga ccttgaatct gatggcaagg gcaaaatttt ggtggaaaag
     2341 gttaagaaca cctctataca gaccaacaac gagttggctg gggccctgca ccatctcaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctactc catcatacaa
     2461 attgccggcg ctgcgtttgt caccacgcgc attgcacgcc gcatgaacat acaagaactc
     2521 tggtcgaagc cacaattaga tcaaaatgaa tcagagacta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcca gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca ttgccaaggc cacggaagaa
     2821 gacttttgtg aagaggagga gatcaaaatc cgccagagaa ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagagggc cacattaggg ctagtaacag gttcagaaat tagaaaaaga
     2941 aaccctgatg acttcaaacc caaaggaaag ctgtgggccg atgacaacag gagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtatcacca agccttttca taacatcaac tcatgtaatc
     3121 cccgcaggca taacagaagc atttggagtc cccatcaaac aaattcagat ccacaaatca
     3181 ggtgaatttt gccgattcag attcccaaaa ccaattagac cagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggcaccgtg gcaactgtgc tcatcaaacg ccccaccgga
     3301 gagctcatgc ctcttgcagc cagaatggga acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacaaatggg tatgttgctc actggatcaa atgctaaagg aatggatttg
     3421 ggaacgactc ctggtgactg tggctgccct tacatctata agaggggcaa tgactatata
     3481 gccattgggg tgcacactgc agcagcccgt ggtggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggggg tgcaccaaaa ttgagcacca aaaccaaatt ttggagatca
     3661 tcgaacacgc cccttccacc aggtacatat gagcctgcct acctcggtgg ccgtgatccg
     3721 cgtgttaagg gtgggccttc cctgcagcaa gtaatgagag accagttgaa gccattcact
     3781 gaacccaggg gcaaacctcc aagaccaagt gtattggaag cagccaaaca aaccatcatc
     3841 aatgtccttg aacaaaccct ggacccccca caaaattgga catacgcaca ggcgtgtgcc
     3901 tcacttgaca aaaccacctc tagcgggcat ccccatcacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taaactggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtac acagcagcac tcaaggacga gctagtcaag
     4081 actgagaaaa tctatggaaa gatcaagaag agactgctct ggggctctga cttgtctacc
     4141 atgatccggt gcgctaggtc atttggcggg ctcatggatg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaatatg aatgaagatg gcccaataat atttgagaaa
     4261 cattccaggt acaaatatca ctatgatgca gactactctc gttgggattc aacacaacag
     4321 agggcagtac tagcagcagc cttggaaatc atggtcagat tctctgcaga accacaattg
     4381 gcacaaatag tcgccgagga tctgctggcc cctagtgtgg tagatgtagg agactttaaa
     4441 attacaataa atgaagggct cccttctggt gtgccatgca cttctcaatg gaactccatc
     4501 gcacactggt tgctaactct ctgtgccttg tctgaagtca ccaaactgtc ccctgacatt
     4561 atacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgacata
     4621 aaattggacc ctgaacagtt aaccgccaaa ttgagggagt acggcctgaa accaacccgc
     4681 ccagacaaaa ctgagggacc cctgattatc agtgaagatc tgaacggtct cactttcctc
     4741 cgaaggacgg tgactcgtga cccagctggc tggtttggaa aactggacca aagctcaatc
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccattctc aaagacccat acagctcatg gcacttcttg gtgaagcctc tcttcacggg
     4921 ccctctttct acagtaaaat cagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 atgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgccgctcca tctactgatg gtgcagccgg cctcgtgcca gaaagtaaca atgaggtcat
     5161 ggctcttgaa cctgtggctg gtgccgcctt ggcagccccg gtcaccggtc aaacaaatat
     5221 tatagaccct tggattagag caaattttgt ccaggccccc aatggtgaat ttacagtctc
     5281 tccccgaaat gcccctggtg aagtgctact gaatctagag ttgggtccag aattaaatcc
     5341 ttatctggca catttagcaa gaatgtacaa tgggtatgcc ggtggtatgg aggtgcaggt
     5401 catgttggct gggaacgcgt tcacagccgg caagttggtc ttcgccgccg tgccacctca
     5461 cttcccggtt gaaaacctta gcccacagca aatcaccatg ttccctcatg tgatcataga
     5521 tgtgagaacc ttggaacctg ttttattacc actccctgat gttaggaata acttcttcca
     5581 ttataatcag aaagatgatc ccaagatgag aattgtggct atgctttata cccccctcag
     5641 gtctaatggt tcaggtgatg atgtgtttac agtctcctgt agagtgttga ctagaccttc
     5701 ccctgacttt gacttcacat acctggtgcc accaacagtg gagtctaaaa caaagccatt
     5761 caccctccca atcctcacac ttggggaact ttccaattct aggttcccag tgtccataga
     5821 ccagatgtat accagcccta atgaagttat atcagtgcag tgtcaaaatg gtaggtgcac
     5881 actggacggg gagctccaag ggacaacaca actcccagtc agtggcattt gtgctttcaa
     5941 aggtgaagtg accgcccact tgcatgacaa tgatcaccta tataatgtta ccatcacaaa
     6001 cttgaatggg tccccttttg atccctccga ggacatccct gcccctctgg gcgtgcctga
     6061 cttccaggaa agggtttttg gtatcatctc ccaaagagac aaacacaata gtcctgggca
     6121 taatgaacca gcaaacaggg gacacgacgc tgtggtcccc acttacacag cacagtacac
     6181 tccaaaactg ggacaaattc aaattggcac atggcagact gacgacctta cagtcaacca
     6241 accagtcaaa ttcaccccag ttggactcaa tgacactgaa cattttaacc aatgggtggt
     6301 ccctaggtat gctggtgccc taaacctcaa tacaaacctt gccccttctg ttgctccagt
     6361 atttccagga gagcgcctgc tcttcttcag atcatacatt cccctcaagg gcggttatgg
     6421 aaacccagcc attgattgcc tactaccaca agagtgggtg caacacttct atcaggaagc
     6481 agccccttca atgagtgagg tggccctcgt cagatacatc aacccggaca ctggtcgggc
     6541 actgtttgag gccaagctcc acagagctgg cttcatgaca gtctcgagca acaccagtgc
     6601 cccggtggtt gtgcctgcca acggatactt cagatttgat tcttgggtaa accaattcta
     6661 ttctctcgcc cccatgggaa ctggaaatgg gcgtagaagg gttcaataat ggctggagct
     6721 tttgtagctg gtcttgcagg ggacgtgctc agcaatgggc ttagttcatt aatcaatgca
     6781 ggtgctaatg caataaatca gagggcagaa tttgatttta atcagaaatt gcagcaaaat
     6841 tcttttaatc atgataagga gatgttgcag gctcagattc aggcaactaa gcagctgcag
     6901 gcagacatga tggctataaa acaaggggtc ttgaccgctg gcggcttttc ccctgctgat
     6961 gcagccagag gtgctgtgaa cgcgcccatg acacaggcgc tggattggaa tggcacaagg
     7021 tattgggcac caaactccat gaggaccaca tcttattctg gaaaattcac atcaaccgcc
     7081 ccagtgaggc aggctgactt ccagcacacc caaagccggc cttcgagtgg ctcttctgtg
     7141 tcttcctttg ccactcagtc ttcaaggcca actctgacca caaccactgg tccctcacat
     7201 ggcacagcct catcaaattc aactcgcagc acaagcctct cccaatcaac ggtctccaga
     7261 gctacatcta ggactggtga gtgggttaga gatcaaaata gaaatttgga accctacatg
     7321 catggtgcct tgcagacagc ctttgtcacc ccaccttcca gcagggcatc tgacgggaca
     7381 gtctcaaccg tcccgaaagg tgttttggac tcctggacac ctgcgtttaa cacccgcagg
     7441 cagccgcttt ttgcacacct ccgtaagagg ggggagtcac aagcttagtg aaaaggtgaa
     7501 aatttattta ggatgaatta attttacctt ttaaaa
//