Typing tool

Complete norovirus genomes

MK483909  GII.4 Sydney
 GII.P16

Length: 7,584 | 3 CDS

ORF1: 3..5102
ORF2: 5083..6705
ORF3: 6705..7511
LOCUS       MK483909                7584 bp    RNA     linear   VRL 23-APR-2019
DEFINITION  Norovirus GII isolate
            Hu/GII.P16-GII.4/RUS/Novosibirsk/NS18-A1494/2018, complete genome.
ACCESSION   MK483909
VERSION     MK483909.2
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7584)
  AUTHORS   Zhirakovskaya,E., Tikunov,A., Kravchuk,B. and Tikunova,N.
  TITLE     Molecular epidemiology of human norovirus associated with sporadic
            gastroenteritis in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7584)
  AUTHORS   Zhirakovskaya,E., Tikunov,A., Kravchuk,B. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2019) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
COMMENT     On Apr 23, 2019 this sequence version replaced MK483909.1.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7584
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.4/RUS/Novosibirsk/NS18-
                     A1494/2018"
                     /isolation_source="diarrheal feces"
                     /host="Homo sapiens; sex: F; age: 15 Y"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="03-Mar-2018"
                     /note="genotype: GII.P16/GII.4_variant _Sydney_2012"
     gene            3..5102
                     /gene="ORF1"
     CDS             3..5102
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBF80274.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARS
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQIDQNESEAKEE
                     VPKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPRPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLESAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSRISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     3..998
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     999..2096
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2097..2627
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2628..3026
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3027..3569
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3570..5099
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5083..6705
                     /gene="ORF2"
     CDS             5083..6705
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="QBF80275.2"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     gene            6705..7511
                     /gene="ORF3"
     CDS             6705..7511
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid proteinVP2"
                     /protein_id="QCE20584.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARITTYNTGHFSTPQPSRALPERANLRGAVPARGPSNKPS
                     NSSTATSVYSNQTISTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7512..7563
ORIGIN      
        1 gaatgaagat ggcgtctaac gacgctaccg ttgccgttgc ttgcaacaac aacaacgaca
       61 aggaaaaatc ttcaggtgaa ggcttattca caaatatgtc ttccacctta aagaaagccc
      121 tcggggctag gtccaaacag cctgccccga gagacgaacc acaaaagccc ccaagaccac
      181 caactcccga gttggtcaag aggatacccc ctcccccacc taatggcgaa gaagaagaag
      241 aaccagtcat taggtatgag gttaagagtg ggatctctgg cctgcccgag ctcacaacag
      301 tcccccaacc ggacgtggcc aacacagcat tcagtgttcc accactgagc ttgagagaaa
      361 acagggaggc caaggaaccg ctaacagggg caatactaga gatgtgggac ggagagatat
      421 accactatgg cctgtacgtg gagaaaggct tagtgctggg tgtgcacaaa ccacctgcag
      481 ccataagcat ggcaagagtg gagctaacgc cgctgtcatt gtactggcgt gtggtgtaca
      541 ctccccaata cctcatctcc cctgaaactc tcaggaggct caacggagag gcgttccctt
      601 acaccgcctt cgacaacaac tgctatgcct tttgctgctg ggtgttagac ctcaatgact
      661 catggcttag caggaggatg gtgcaaagaa caacgggctt cttcagacct taccaagagt
      721 ggaacagaaa acccctgccc accatggatg actccaaaat aaagaaggta gcaaatatat
      781 tcctatgttc actgtccaca ttgttcacca gacctataaa agacctcata ggaaaaatta
      841 aaccattaaa catattgaac atcctggcaa cgtgtgactg gacgtttgcc ggaatagtgg
      901 agtctctgat attacttgct gaactcttcg gagttttctg gacaccccca gatgtgtctg
      961 ctatgatcgc ccccttactc ggggactacg agttgcaagg gccagaagac ctcgccgttg
     1021 aactcgtacc tgtggtaatg ggagggattg gtttggtgtt gggattcacc aaagagaaaa
     1081 ttggcaaaat gttgtcctca gcagcatcaa cacttagggc ttgcaaagat cttggtgcct
     1141 atggcttaga gatactcaaa ttggtcatga agtggttctt cccaaagaaa gaggaggcca
     1201 atgagctagc catggtgagg gccatagagg atgccgtact agatcttgag gcaatagaaa
     1261 ataaccacat gacaaccctg ttgaaagaca aagacagctt agcaacatac atgaaaacac
     1321 tggacatgga ggaggagaaa gccagaaggt tgtccacaaa atctgcatcc cctgacatag
     1381 ttgggacaat caacgccctg ctggctcgaa tagcagcagc caggtcatta gtccacaggg
     1441 ccaaggaaga gctatctagc aggatgagac cagtggttgt tatgatatct ggtaaaccag
     1501 gaataggcaa aactcatctg gccagggagg tggcaagaaa ggtagcatcc actctcacag
     1561 gggatcaaag agtcggactc ataccaagaa acggtgtgga ccattgggat gcatacaaag
     1621 gtgagagagt cgtgctgtgg gacgactatg gcatgagtaa ccccattcat gatgctcttc
     1681 gcatacaaga attggctgat acgtgccccc ttaccttaaa ttgtgacaga attgaaaata
     1741 agggaaaagt ttttgacagt gaagtcataa taattacaac aaaccttgcc aacccagccc
     1801 cacttgatta tgtcaacttt gaggcctgtt ccaggagaat tgatttcctg gtgtacgctg
     1861 aggcaccaga agtggaaaag gcaaaacggg attttcctgg ccagccagat atgtggaagg
     1921 acgccttcaa gtcggacttt tcacacatca agctacagct tgcacctcaa ggcggctttg
     1981 acaagaatgg caacacccca catgggaaag gggtgatgaa gaccctcact accggttctc
     2041 tgattgcccg tgcatcgggc ctactacatg agaggatgga tgaatttgaa ctccaaggtc
     2101 ccacaatcac caccttcaat ttcgaccgga acagaatcac agcattcaga caattggctg
     2161 cagaaaacaa gtatgggttg gtggatacca tgaaagttgg caatcaacta aaaggagtga
     2221 aaaccatgga agaactcaaa caagcaatca ggaatgtgac catcaagagg tgccggatca
     2281 tctacggtgg ctctacgtat gaccttgaat ctgatggcaa gggcaaagtt ttggtggaaa
     2341 aggtcaagaa cacctctgta cagaccaaca acgagttggc cggggccctg caccatctca
     2401 aacacgcccg aatcaggtac tatgtcaaat gtgtgcaaga agcagtctat tccatcatac
     2461 aaattgccgg cgctgcgttt gtcaccacgc gcattgcacg ccgcatgaac atacaagaac
     2521 tctggtcgaa gccacaaata gatcaaaatg aatcagaagc taaggaagag gtccccaagt
     2581 cagaagacga cgagttcatc atatcttcta aggacatcaa ggaggaagga aagaagggca
     2641 aaaacaaaac tggccgtggc aagaaacaca ctgcattctc cagcaagggc ttgagcgatg
     2701 aggagtatga cgagtacaag agaataagag aagagagaaa tgggaagtac tctatagagg
     2761 agtatcttca agacagagac aggtactatg aggagctcgc cattgccaag gccacggaag
     2821 aagacttctg tgaagaggag gagatcaaaa tccgccagag aattttccgt cccaccagga
     2881 agcaaagaaa ggaagagagg gccacattag ggctggtaac aggttcagaa atcagaaaaa
     2941 gaaatcctga tgacttcaaa cccaaaggga agctgtgggc cgatgacaac agaagtgttg
     3001 actacaatga gaaactggac tttgaggccc ccccaagcat atggtctagg attgtgaact
     3061 ttggttctgg ctggggcttc tgggtgtcac caagcctgtt cataacatca actcatgtaa
     3121 tccccgcagg cataacagaa gcatttggag tccccatcaa acaaattcag atccacaaat
     3181 caggtgaatt ttgccgattc agattcccaa gaccaattag accagatgtg acaggaatga
     3241 tcttggaaga aggtgcgcct gaaggcaccg tggcaactgt gctcatcaaa cgccccaccg
     3301 gagagctcat gcctcttgca gccagaatgg gaacacacgc aaccatgaaa attcaaggcc
     3361 gcatggttgg cggacagatg ggcatgttgc tcactggatc gaatgctaaa ggaatggatt
     3421 tgggaacaac tcctggtgac tgtggctgtc cttacatcta taaaaggggc aatgactata
     3481 tagtcatcgg ggtgcacact gcagcagccc gtggtggaaa caccgtcatc tgtgccacac
     3541 agggaagtga gggtgaggca actcttgagg gtggagatga taaaggaaca tactgtgggg
     3601 cacccatttt gggccctggg ggtgcaccaa aattgagcac caaaaccaaa ttttggaggt
     3661 catcgaacac gccccttcca ccagggacat atgagcctgc ctacctcggt ggccgtgatc
     3721 cgcgtgttaa gggtgggccc tccttgcagc aggtaatgag agaccagttg aagccattca
     3781 ctgaacccag gggcaaacct ccaagaccaa gtgtattgga atcagccaaa caaaccatta
     3841 tcaatgttct cgaacaaacc ctggaccctc cacaaaaatg gacatatgca caggcgtgtg
     3901 cctcacttga caaaaccacc tccagcgggc atccccatca cgtccgaaag aatgaattct
     3961 ggaatggtga gaccttcact ggtaaattgg cagaccaagc atcaaaagca aacctaatgt
     4021 ttgaggaagg gaaacacatg acaccagtgt acacagcagc actcaaggac gagctagtta
     4081 agactgagaa aatctatgga aagatcaaga agagactgct ctggggctct gacttgtcca
     4141 ccatgatccg gtgcgctagg tcatttggtg ggctcatgga cgagatgaag gcacactgca
     4201 tatcactccc agtacgagtt ggcatgaata tgaatgaaga tggcccaata atatttgaga
     4261 aacattccag atataaatac cattatgatg cagactactc tcgttgggat tcaacacaac
     4321 agagggcagt actagcagca gccttggaaa tcatggtcag attctctgca gaaccacaat
     4381 tggcacaaat agtcgctgag gatctactgg cccctagtgt agtagatgta ggagacttta
     4441 aaatcacaat aaatgagggg ctcccatctg gtgtgccatg tacttctcaa tggaactcca
     4501 tcgcacactg gctgctaact ctctgtgcct tgtctgaagt cactaaattg tcccctgaca
     4561 ttatacaagc aaattccatg ttctcatttt acggtgatga cgagattgtc agcaccgaca
     4621 taaaattgga ccctgaacag ttaaccgcca agttgaagga gtacggcctg aaaccaaccc
     4681 gcccagacaa gaccgaggga cccctgatca tcagtgaaga tttgaacgga ctcactttcc
     4741 tacgaaggac ggtgactcgt gacccagctg gctggtttgg aaaactggac caaagttcaa
     4801 ttttgaggca gatgtactgg actagaggac caaatcatga agatcccaat gagacaatga
     4861 taccccattc tcaaagaccc atacagctca tggcactgct tggtgaagcc tctcttcacg
     4921 gaccctcttt ctacagtaga atcagtaaat tggttataac tgaactcaaa gaaggtggga
     4981 tggactttta cgtgccaagg caggaaccca tgttcaggtg gatgaggttt tctgacttga
     5041 gcacgtggga gggcgatcgc aatctggctc ccaattttgt gaatgaagat ggcgtcgagt
     5101 gacgccaacc catctgatgg gtccgcagcc aacctcgtac cagaggtcaa caatgaggtt
     5161 atggctttgg agcccgttgt tggtgccgct atcgcggcac ctgtagcggg ccaacaaaat
     5221 gtaattgacc cctggattag aaataatttt gtacaagccc ctggtgggga gtttacagtg
     5281 tcccctagaa acgctccagg tgaaatacta tggagcgcgc ccctaggccc tgatttaaat
     5341 ccctacctat cccatttggc cagaatgtat aatggttatg caggtggttt tgaagtgcag
     5401 gtaattctcg cggggaacgc gttcaccgcc gggaagatta tatttgcagc agtcccacca
     5461 aatttcccaa ctgaaggctt aagtcctagc caggtcacta tgttccccca tataatagta
     5521 gatgttagac aactagaacc tgtgctgatt cccttacccg atgttaggaa taatttctat
     5581 cattacaatc agtcaaatga ctccactatt aagttgatag caatgttgta tacaccactt
     5641 agggctaata atgctggaga tgatgttttc acagtttcgt gccgagttct cacgagacca
     5701 tcccccgatt ttgatttcat atttttagtg ccacccacag ttgagtcaag aactaaacca
     5761 ttctctgtcc caattttaac tgttgaggag atgactaatt caagattccc catccctttg
     5821 gaaaagttgt tcacaggccc cagcagtgcc tttgttgttc aaccacaaaa cggcaggtgt
     5881 acaactgatg gcgtgctcct aggcaccacc caactctctc ctgtcaacat ctgcaccttc
     5941 agaggggatg tcacccacat cacaggtagt cgcaactaca caatgaattt ggcttctcaa
     6001 aattggaaca actatgaccc aacagaagaa atcccagccc ctctaggaac tccagatttt
     6061 gtggggaaga ttcaaggcat gctcacccaa accacaagga cagatggttc aacacgcggc
     6121 cacaaagcta cagtgtacac tggaagtgcc gactttgctc caaaactggg tagagttcaa
     6181 tttgaaactg acacagacca tgattttgaa gctaatcaaa atacaaagtt caccccagtc
     6241 ggtgtcatcc aagatggtag caccacccac cgaaacgaac cccaacagtg ggtgctccca
     6301 agttactcag gcagaaacac tcacaatgta catttggccc ccgctgtagc ccccaccttt
     6361 ccgggtgagc aacttctctt cttcagatcc accatgcccg gatgcagcgg gtaccccaac
     6421 atggatttgg actgtctgct cccccaggaa tgggtgcagt acttctacca agaggcagcc
     6481 ccagcacaat ctgatgtggc tttgctaaga tttgtgaatc cagacacagg tagggttttg
     6541 tttgagtgca agcttcataa atcaggctat gttacagtgg ctcacactgg ccaacatgat
     6601 ttggttatac cccccaacgg ttactttagg tttgattcct gggtcaacca gttctacaca
     6661 cttgccccca tgggaaatgg aacggggcgt agacgtgtag tataatggct ggagctttct
     6721 ttgctggatt ggcatctgat gtccttggct ctggacttgg ttcccttatc aatgctgggg
     6781 ctggggccat caaccaaaaa gttgaatttg aaaataacag aaaattgcaa caagcatcct
     6841 tccaatttag cagtaatctg caacaggctt ccttccaaca tgataaagag atgctccaag
     6901 cacaaattga ggccaccaaa aagctacaac aggaaatgat gaaagttaag caggcaatgc
     6961 tcctagaggg tgggttctct gagacagatg cagcccgcgg ggcaattaac gcccccatga
     7021 caaaagcttt ggactggagc gggacaaggt attgggctcc agatgctagg attacaacat
     7081 acaatacagg ccacttttcc acccctcaac catcgagggc actgccagaa agagctaatc
     7141 ttaggggtgc tgtccctgct cgaggaccct ccaacaaacc ctctaactct tctactgcca
     7201 cctctgtgta ctcaaatcaa actatttcaa cgagacttgg ttctacagct ggttctggaa
     7261 ccagtgtctc gagcctcccg tcaactgcaa ggactaggag ctgggttgag gatcaaaata
     7321 ggaatttgtc acctttcatg aggggggccc acaacatatc atttgtcacc ccaccatcta
     7381 gcagatcctc tagccaaggc acagtctcaa ccgtgcctaa agagattttg gactcctgga
     7441 ctggcgcttt caacacgcgc aggcagcctc tcttcgctca cattcgtaag cgaggggagt
     7501 cacgggtgta atgtgaaaag acaaaactga ttatttttct ttttcttttc tttagtgtct
     7561 tttaaaaaaa aaaaaaaaaa aaaa
//