Typing tool

Complete norovirus genomes

MK483908  GII.1
 GII.P16

Length: 7,539 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7471
LOCUS       MK483908                7539 bp    RNA     linear   VRL 23-APR-2019
DEFINITION  Norovirus GII isolate
            Hu/GII.P16-GII.1/RUS/Novosibirsk/NS18-A1400/2018, complete genome.
ACCESSION   MK483908
VERSION     MK483908.2
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7539)
  AUTHORS   Zhirakovskaya,E., Tikunov,A., Kravchuk,B. and Tikunova,N.
  TITLE     Molecular epidemiology of human norovirus associated with sporadic
            gastroenteritis in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7539)
  AUTHORS   Zhirakovskaya,E., Tikunov,A., Kravchuk,B. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2019) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
COMMENT     On Apr 23, 2019 this sequence version replaced MK483908.1.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7539
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.1/RUS/Novosibirsk/NS18-
                     A1400/2018"
                     /isolation_source="diarrheal feces"
                     /host="Homo sapiens; sex: F; age: 21 Y"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="11-Jan-2018"
                     /note="genotype: GII.P16/GII.1"
     5'UTR           1..4
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QBF80272.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDKPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PDVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKPDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESEPKEE
                     APKSEDDEFVISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVSIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTVINVLEQTLDPPQKWTYVQACASLDKTTSSGYPHHIRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5085..6692
                     /gene="ORF2"
     CDS             5085..6692
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="QBF80273.2"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPFLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPLENLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQPEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELSNSRFPAPIDELYTSPNEGVVVQPQNGRSTLDGELLGTT
                     QLVPSNICAMRGRINAQVPDDHHQWNLQVTNTNGTPFDPTEDVPAPLGTPDFLANIYG
                     VTSQRNPDNTCRAHDGVLATWSPKFTPKLGSVVLGTWEDRDFDLNQPTRFTPVGLYDT
                     EHFDQWVLPNYSGRLTLNMNLAPSVSPLFPGEQILFFRSHIPLKGGTSNGAIDCLLPQ
                     EWIQHFYQESAPSPTDVALIRYTNPDTGRVLFEAKLHRQGFITVANSGSRPIVVPPNG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6692..7471
                     /gene="ORF3"
     CDS             6692..7471
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid proteinVP2"
                     /protein_id="QCE20583.1"
                     /translation="MAGAFIAGLAGDIVTNGIGTLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQILATKQLQADMIALRQGVLTAGGFSPTDAARGAVGAPMTQVLDWNG
                     TRHWAPGAIKTTSFSGGFTSSSHARTLDLPKKTTTAPTPMPVSRPSSSASTVSTRSTV
                     ISGSSNPPSSIRSSSSVSSQSTPSSSRVSEWVQNQNRALEPYMRGALQTAYVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSVFNTHRQPLFAHLRRRGESQA"
     3'UTR           7472..7518
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc aggcccaaac aacctgcccc gagagacaaa ccacaaaagc ccccaagacc
      181 accaaccccc gagttggtca agaggatacc ccctcctcca cctaatggtg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccag ccggacgtgg ccaatacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggcctgtacg tggagaaagg cttagtgctg ggtgtgcaca aaccacctgc
      481 agccataagc atggcaaaag tggagctgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcaggagg ctcaacggag aggcattccc
      601 ttacaccgcc tttgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctc agcaggagga tggtgcaaag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga acatcctggc aacatgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgagttgcaa gggccagaag acctcgccgt
     1021 tgaactcgta cctgtggtaa tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacgctcagg gcttgcaaag atcttggtgc
     1141 ctatggctta gagatactca aattagtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggatgctgta ctagatcttg aggcaataga
     1261 aaataatcac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 attggacatg gaggaggaga aagccagaag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgttggctcg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctatcta gcaggataag accagtagtt gttatgatat ctggcaaacc
     1501 aggaataggc aaaactcatc tggccaggga ggtggcaaga aaggtggcat ccactctcac
     1561 aggggatcaa agagtcggac tcataccgag aaacggtgtg gaccattggg acgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagc aaccccattc atgatgctct
     1681 tcgcatacaa gaattggctg atacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 caaaggaaaa gtttttgaca gtgaagtcat aataatcaca acaaatcttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaaacg ggattttcct ggtcagccag atatgtggaa
     1921 ggacgccttc aagccggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aacttcaagg
     2101 tcctacaatc accaccttca atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagagaac aagtacggac tggtggatac catgaaagtt ggcaatcaat taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtg accatcaaga ggtgccggat
     2281 catctacggt ggctccacat atgaccttga atctgatggt aagggcaaag ttttggtaga
     2341 aaaggtcaag aacacctctg tgcagaccaa caacgagttg gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attctatcat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag cctaaggaag aggcccccaa
     2581 gtcagaagat gacgagttcg tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaataaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag acaggtacta tgaggagctc gccattgcca aggccacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtatc accaagcctg ttcataacat caactcatgt
     3121 aatccccgca ggcataacag aagcatttgg agtctccatc aaacaaatcc agatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaaaccaatt agaccagatg taacaggaat
     3241 gatcttggaa gaaggtgcgc ctgagggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat gggaacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactgga tcaaacgcta aaggaatgga
     3421 tttgggaact actcctggtg actgtggttg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaat acaccccttc caccagggac atatgagcct gcctacctcg gcggccgtga
     3721 tccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ccccaagacc aagtgtattg gaagcagcca aacaaaccgt
     3841 catcaatgtc ctcgaacaaa ctctggaccc tccacaaaaa tggacatacg tacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gtacccccat cacatccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctgat
     4021 gtttgaggaa gggaaacaca tgacaccagt atatacagca gcactcaagg acgagctagt
     4081 caagactgag aaaatctatg gaaagatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtccgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatataagt accactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactggcag cagccttaga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagttgctg aggatctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaattaca ataaatgaag gactcccctc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgcgc cttgtccgaa gtcaccaaac tgtcccctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 cataaaattg gaccctgaac agttaaccgc caaattgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aaaaccgagg ggcccctgat catcagtgaa gatttgaacg gactcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggctggttt ggaaaactgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaaccat gaagacccca atgagacaat
     4861 gataccccat tctcaaagac ccatacagct tatggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaatcagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgcag ccggtctcgt accagaggtc aacaacgaga
     5161 cgatggcact tgaaccggtg gctggggctt ccatagctgc ccccctgacc ggtcaaaaca
     5221 atgtgataga cccctggatt agaatgaact ttgtccaagc cccaaatggt gaatttacag
     5281 tgtccccccg taattcccca ggtgaagtat tgctaaattt ggaattaggt cctgaattga
     5341 atccattctt ggcgcacctt tcaagaatgt acaatggtta tgcagggggg gttgaagtgc
     5401 aggtgctgct cgctgggaac gcgtttacag cggggaaact ggtatttgca gcaatccctc
     5461 cacattttcc ccttgaaaat ttgagccctg gacaaattac tatgtttcct catgtgatta
     5521 ttgatgttag gacgttagaa cctgtcctct tacctctccc agatgttaga aataacttct
     5581 tccattacaa tcagcaaccc gaaccccgaa tgaggcttgt tgctatgttg tatacccctc
     5641 ttagatctaa tggttctggt gatgatgtgt ttacagtttc ttgcagggtt ctcacccgcc
     5701 cttctcctga ctttgatttt aactatttgg ttcccccaac agtggagtcc aaaacaaaac
     5761 cattcaccct accaattttg actattgggg aattgtcaaa ttctaggttc ccagctccaa
     5821 tagatgaact gtataccagc cccaatgaag gagtggtggt gcaaccacaa aatggtagat
     5881 caacactcga tggtgaacta ctgggcacca cacaacttgt gccttcaaac atttgtgcga
     5941 tgcgaggacg catcaatgcc caagtgccag acgatcacca tcaatggaac ttgcaggtca
     6001 caaatacaaa tgggaccccc ttcgacccca ccgaagatgt ccctgcacca ttgggcacgc
     6061 cggacttcct ggcaaacatc tatggagtca ccagtcagag aaacccagac aatacttgtc
     6121 gtgcccacga cggggttttg gcaacttgga gccctaagtt cacacccaaa ttgggatccg
     6181 ttgtcctagg tacctgggaa gatagagact ttgatcttaa ccaacccaca aggttcacac
     6241 ctgttggatt gtatgataca gaacattttg accagtgggt cctgcctaat tactctggaa
     6301 gattgacctt gaacatgaat ttggcaccct ctgtatctcc cctctttcca ggtgaacaaa
     6361 tactcttctt taggtcccat ataccactta agggaggcac ttctaatggt gccattgact
     6421 gcctgctacc ccaggaatgg attcagcatt tctaccagga atcagccccg tcacccacgg
     6481 atgtggctct aattaggtat accaaccctg acacaggtcg agtcttgttt gaggccaaat
     6541 tgcacagaca ggggttcatt acagtggcaa attctggttc taggcctatt gttgttcctc
     6601 ctaatggtta ttttagattt gattcttggg ttaatcaatt ttattctctt gcccccatgg
     6661 gaactggtaa cgggcgtaga agggtgcagt aatggctgga gcttttatag caggtcttgc
     6721 tggtgacata gtcaccaatg gcattgggac actggtaaat gctggggcaa atgcaataaa
     6781 tcaaaaggta gattttgaaa ataacaagca attacaacaa gcctctttca atcatgataa
     6841 ggaaatgttg caagcccaga ttttggcaac aaaacagtta caggctgata tgattgctct
     6901 cagacaaggg gtgttgaccg cgggcggctt ctctcctact gatgcagcaa ggggggcggt
     6961 tggtgcacct atgacgcaag tcttggactg gaatgggact aggcattggg cccctggagc
     7021 cataaaaaca acatctttct ccggtgggtt cactagctct tcccatgcta gaactcttga
     7081 tttgccaaag aaaacaacaa ctgcaccaac cccgatgcct gtatctagac ccagttcttc
     7141 tgcttctaca gtttctaccc gctcaacagt cattagtggg tcctctaatc ccccttcctc
     7201 gattaggagc tcctctagtg tttcttccca atctactccc tcttcttccc gggttagtga
     7261 gtgggtgcaa aatcagaata gggcactgga gccgtatatg aggggggcgc tacaaacagc
     7321 ttacgtgacg cccccctcca gtagggcttc cagtagtggc acagtctcaa ccgtgccaaa
     7381 agaagttttg gactcctgga catctgtgtt caacacccac agacagccgc tcttcgctca
     7441 tctccgtcgg agaggggagt cacaggctta gtgaaaaggt aattttcttc ttttcttcct
     7501 tggaaaattt tatcttttaa aaaaaaaaaa aaaaaaaaa
//