Typing tool

Complete norovirus genomes

MK282256  GII.17
 GII.P17

Length: 7,601 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6710
ORF3: 6710..7489
LOCUS       MK282256                7601 bp    RNA     linear   VRL 30-JAN-2019
DEFINITION  Norovirus GII isolate CMC-01, complete genome.
ACCESSION   MK282256
VERSION     MK282256.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7601)
  AUTHORS   Kim,H. and Paik,S.-Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2018) Department of Biomedical Sciences, College
            of Medicine, The Catholic University of Korea, 222 Banpo-daero
            Seocho-gu, Seoul, Seoul 137-701, Korea
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7601
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="CMC-01"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="South Korea"
                     /collection_date="2013"
                     /note="genotype: GIIP.17_GII.17"
     gene            5..5113
                     /gene="ORF1"
     CDS             5..5113
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="QAT98494.1"
                     /translation="MKMASNDASAAVAGKNNNNDKEKSSSDSLFANMSVTFKKALGAR
                     SKQPPPGETKQIQKPPRPPTPELVKRIPPPPPNGEDEPGIVYKVGEGVSGLPDLTTVV
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHVLGVHKPPA
                     AISLAKIEITPLSLYWRVVYTPQYLIDPGTLKNLSGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRLIQRPSGFFRLYQDWNRKPLPTMDEPKIKKAANAVLCALSSLFTRPIKDI
                     IGKLRPLNILNVLATCDWTFAGIVESMILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAATTLRACKDLGSYGLEILKLVMKW
                     FFPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINSLLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKVASTLSGDQRIGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHYRPDFTHIKLQLAPQGGFDKNGNTPHGKGVVKSLTIGSLI
                     ARASGLLHERMDEFELQGSDLPTFNFDRNKVAAFRQLAAENKYGLMDTLRVGNQLKSV
                     KTLDELKQAIKNISFKKCQIVYNGCTYTMESDGRSKVVVEKVQNATVQTNNELVGALH
                     HLRSARIRYYVKCFQEAIYSLLQIAGAAFVTSRIVRRMNISNLWSKPPIEEGDEPEDK
                     GGCPKPRDEDDLTIDSRDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPINQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVVSILIKRTTGELMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYIYKRGNDFVAIGVHTAAARGGNTVICATQGSEGEATLEGGDNRGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPNVLESAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWSGESFTGKLADQASKANLMYEEGKHMQPVYTAALKDELVKADKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDELKANCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLSPSVVDVGDFKIAINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQNSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..1003
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1004..2101
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2102..2638
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2639..3037
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3038..3580
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3581..5110
                     /gene="ORF1"
                     /product="RdRp"
     gene            5094..6710
                     /gene="ORF2"
     CDS             5094..6710
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="QAT98495.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
                     NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNTFFHYNNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
                     SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
                     QLLPSGICAFRGRVTAETDHRDKWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGV
                     ASQRNVGNDAPGSTRAHEAVISTYSPQFVPKLGSVNFRSNDNDFQLQPTKFTPVGIND
                     DGDHPFRQWELPDYSGLLTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIVDCL
                     IPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLVVP
                     ANGYFRFDSWVNQFYSLAPMGTGNGRRRAQ"
     gene            6710..7489
                     /gene="ORF3"
     CDS             6710..7489
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QAT98496.1"
                     /translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
                     SFQHDEEMLQAQVKATKQLQSEMIALKQGVLAAGGFSPTDAARGAIGAPMTKVLDWSG
                     TRYWAPNSTKTTGYSGQFTSSPVRMPSPNAPQSKPAKPRSLAPSSSSSSVYSMSTQST
                     HLTSGSSSNASSASTKLTNLSSGSSQNRTAEWVDQQRSLSPFMSGALNISHVTPPSSR
                     ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggaa aaatcttcaa gtgacagctt gtttgctaac atgtctgtta cttttaagaa
      121 agccctcggg gcgcggtcta aacaaccgcc cccgggagaa acaaaacaaa tacaaaaacc
      181 accaaggcca ccgacaccgg aattggtgaa gagaatacct ccacccccac ccaatggcga
      241 ggatgaacca gggatagtgt acaaggtggg agagggtgtg tctgggctgc ccgacctaac
      301 aactgtggta caacctgacg cacaaaacac agcttatagt gttcccccac ttagccagag
      361 agaagtcggc gaagctaaag aaccgctgcc tggctccatt ctggaaatgt gggatggtga
      421 gatctaccac tatgggctgt atgttgagcg ggggcatgtg ctcggagtac acaaaccacc
      481 tgctgcaata agccttgcca aaattgaaat aacaccgctg tctctctact ggagagtggt
      541 ctacactccc cagtatttga tagatccagg aactcttaag aacttgagtg gagagacttt
      601 cccatacacg gcctttgaca acaactgtta tgccttctgt tgttgggtcc tagacctcaa
      661 cgactcctgg cttagcagga gattgatcca aagaccatct ggattcttca gactgtatca
      721 ggattggaac agaaaaccct taccaaccat ggatgaaccg aaaatcaaga aggccgcgaa
      781 tgctgttctg tgcgctctct cctcactctt cactagaccc attaaggaca tcattggaaa
      841 gcttagacca ctgaacattc ttaatgtact ggcaacttgt gactggactt ttgcaggcat
      901 agtggaatcc atgatccttc ttgctgaact ctttggggtg ttctggaccc ccccagatgt
      961 gtctgcgatg attgctccct tactcggtga ctacgagatg caaggccccg aagacctggc
     1021 cgtggaactt gtgcccgtgg taatgggagg aataggtttg gtgttaggat tcaccaagga
     1081 aaagatcggc aagatgcttt catcagctgc gaccacactt agggcctgca aggatctagg
     1141 atcttatgga ttggagatac tcaaattggt catgaagtgg ttcttcccca agaaggagga
     1201 ggctaacgaa ctagccatgg tgagggccat tgaggatgca gtcctggatt tggaggcaat
     1261 agaaaacaat cacatgacca cccttctcaa ggataaagac agcctggcca catacatgag
     1321 gactcttgac ttggaagaag agaaagcaag gaaactgtca accaaatcgg cgtcacctga
     1381 catcgtgggt acaataaact cattattggc aaggatagca gccgccaggt cactggtcca
     1441 caaggctaag gaggagctct cgagcagaca gagacctgtt gttgtaatga tatcaggtag
     1501 accaggtata ggaaagaccc atctggccag agagctagcc aagaaagttg cgtcaacact
     1561 gtcaggcgac caaaggattg gactgatacc tagaaatggc gtcgaccatt gggacgccta
     1621 caagggagaa agggtggttc tgtgggatga ttatggtatg agcaacccta tacaggacgc
     1681 actgaggctc caagaattgg ctgacacctg tcctctgacc ctaaattgtg acaggattga
     1741 aaacaaagga aaagtgttcg acagtgatgc cataattata acaaccaacc ttgcaaaccc
     1801 agcaccacta gactatgtca actttgaggc ctgctctaga cgcatagact tcttggtgta
     1861 tgcagacgca cctgacatcg agaaggctaa gcgtgatttc cctggccaac cagatatgtg
     1921 gaaagaccat tacagaccag acttcacaca cattaaactt cagctggcac cacagggagg
     1981 ttttgacaaa aatggcaaca ccccacatgg caaaggtgtg gtgaagtctc tgacgattgg
     2041 ttctctgatc gccagggctt ctggcttgct ccacgagaga atggatgaat tcgagctcca
     2101 gggctctgac ctgccaacct tcaattttga ccgcaacaaa gtcgccgcct tcagacaatt
     2161 agcagctgaa aacaaatatg gtcttatgga cacactgagg gtcggcaacc aactgaaaag
     2221 tgtcaagacc ctggatgagc tgaagcaggc cataaagaac atcagtttca agaagtgcca
     2281 gatagtgtat aacggatgca cctataccat ggaatctgat gggaggagca aggttgtggt
     2341 tgaaaaggta caaaacgcaa cagttcaaac caacaatgaa cttgtagggg cactccacca
     2401 cctgagatct gcaaggataa gatactatgt taaatgtttc caagaagcca tttactctct
     2461 actccaaatt gctggtgcag ccttcgtcac ctcacgcatc gtgaggcgca tgaacatctc
     2521 aaacctctgg tcgaagccac ccatcgagga gggtgatgag cctgaagaca aaggaggatg
     2581 ccccaagccc agggatgaag atgacctcac tattgactct agagacatta aagtggaagg
     2641 gaagaagggc aagaacaagt ctggccgggg caagaaacac acagccttct catccaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcaga gaggagagga atggcaaata
     2761 ctcaatagag gaatacctcc aagataggga cagatactat gaagagcttg ccattgctaa
     2821 ggccactgag gaggacttct gtgaagagga ggagatcaaa atccgccaga gaatcttccg
     2881 acccaccagg aagcagcgga aagaggaaag ggccacgctt gggcttgtca ccggatcgga
     2941 gatcagaaag aggaatccag atgactttaa accaaaagga aaattgtggg ctgatgacaa
     3001 caggagcgtg gattacaatg agaggataga ttttgaggct cccccgagtg tttggtctag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct ttataacttc
     3121 aacacacgtc ataccaaaag gaatcactga ggcctttgga gtgcccataa accaaatcca
     3181 aattcacaaa tctggagaat tttgccgctt gcggtttcca aagccaatca gaccagacgt
     3241 gagtgggatg atcttggaag agggtgcccc tgaaggcact gttgtgtcta ttctcatcaa
     3301 aaggacaaca ggggagctga tgcctcttgc agtcagaatg gggactcatg ccacaatgaa
     3361 aatccaaggt agaacggtgg gtggtcagat gggtatgctt ctcactggct caaatgctaa
     3421 aagcatggat ctaggcacaa cgccaggtga ctgcgggtgt ccatacatat acaagagggg
     3481 caatgacttc gtggccattg gggtgcacac tgcagcagca cgtggaggca acacggtcat
     3541 atgtgccaca cagggaagtg aaggtgaagc cactcttgaa ggaggtgaca acaggggtac
     3601 ctattgtgga gcccccattt tgggacctgg caatgcacca aaattgagca caaaaactaa
     3661 attctggaga tcctctaacg caccgcttcc cccaggtact tatgaaccag catacctcgg
     3721 tgggagagac ccgcgcgtga agggaggccc atctctgcaa caagttatga gagaccaact
     3781 taaacctttt acagagccca gagggaagcc accaaatcca aatgtcctag agtcagcaaa
     3841 gaagactatc atcaatgttc tggaacaaac cattgacccc cctcaaaagt ggtcatatgc
     3901 ccaagcttgt gcatccctcg acaagacgac ctccagtgga tacccgcacc acgtccggaa
     3961 gaatgactat tggagtggtg aatccttcac agggaaactt gcagaccagg cttcaaaagc
     4021 aaatctcatg tatgaggaag gcaagcacat gcaaccggtt tacaccgcag cactcaaaga
     4081 cgagctcgtg aaagctgaca aaatttatgg caagatcaag aaaagactcc tgtggggttc
     4141 tgacctctcc accatgattc gatgtgccag agcatttggt ggtctcatgg atgagctcaa
     4201 agcaaattgt attacactcc ctatcagagt tggtatgaat atgaatgaag acggtcccat
     4261 aatatttgag aaacactcca ggtacaggta ccactatgat gctgattact cccgctggga
     4321 ctccacacaa cagcgggcag tgctggaagc ggcacttgaa atcatggtga gattttctgc
     4381 tgagccacag ctggcacaaa tagtggcaga ggacctgctg tcaccaagtg tggttgatgt
     4441 gggcgatttc aaaatcgcta tcaatgaagg cctaccatct ggcgtgcctt gcacctcaca
     4501 atggaattct attgcccact ggttactcac cctgtgtgct ctttctgaag tgacaggact
     4561 aggtcctgac atcatacaag ccaactccat gtactctttc tatggtgatg atgagattgt
     4621 gagcacagac ataaaattgg acccagagaa attgaccgca aagctcaaag aatatggcct
     4681 taaacccact cggcccgaca aaactgaggg gccgctggtg attagtgaag acctgaatgg
     4741 gttgactttc ctccgccgaa cagtcacccg tgatccagca ggttggtttg gaaagttgga
     4801 ccaaaactcc atcctcaggc agttgtactg gacaagagga cccaaccatg aagaccccag
     4861 tgagaccatg ataccacacg cacagagacc tgtgcagctc atggcactac taggagaatc
     4921 ctccctacat ggaccctcat tttacagcaa ggttagcaaa ctggtcatat ctgaacttaa
     4981 agagggagga atggattttt atgtgcccag acaagagtca atgttcagat ggatgaggtt
     5041 ctcagatcta agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgccgct ccatctaatg atggtgctgc tggtctcgta ccagagggca
     5161 acaacgagac ccttccccta gaaccagttg cgggcgcagc tatagccgca cccgtcactg
     5221 gccaaaacaa cataattgac ccctggatta gaacaaattt tgtgcaagca ccaaatggag
     5281 agttcacagt gtcacccaga aactcccctg gagaaatttt actaaaccta gagttgggcc
     5341 ctgatttgaa cccttatttg gctcatttat caaggatgta caatgggtat gctggtggag
     5401 tggaagttca ggttctcctg gcagggaacg cgttcactgc cggaaagatc ctcttcgccg
     5461 ccgtcccgcc aaatttccca gtggaattct taagcccagc ccagattaca atgctcccac
     5521 atttaatagt agatgtaagg actcttgaac caattatgat cccactccct gatgttagga
     5581 atacattctt ccattataac aaccagccta acagccgcat gagattagtg gctatgctct
     5641 acacccccct tagatctaat ggctcaggtg atgatgtctt tactgtctct tgcagggttt
     5701 tgactaggcc tactcctgat tttgagttca cttatttagt gccaccttct gttgaatcta
     5761 agactaagcc tttttcctta cctattttaa ccctttctga gctcacaaat tcgaggttcc
     5821 cagtccccat cgattcgctt ttcaccgccc agaataatgt gttgcaggtg cagtgtcaaa
     5881 atggcaggtg cacacttgat ggtgagttac aaggcacaac ccagttgctc ccatctggta
     5941 tctgtgcatt cagaggacgg gtgacagcag aaactgacca tcgtgacaag tggcacatgc
     6001 aactgcaaaa cctcaatggc acaacatatg acccaactga tgatgtgcca gccccgctgg
     6061 gtacacctga cttcaagggc gtcgtgtttg gggtagcaag ccaaagaaat gtgggtaatg
     6121 atgcgcctgg ctcaaccagg gcccatgagg cggtgatttc aacctatagc ccccaatttg
     6181 tccccaaatt aggttctgtc aattttagaa gtaatgataa tgatttccaa ttgcagccga
     6241 caaaattcac accagtgggc atcaatgacg atggtgacca cccgttcaga caatgggaac
     6301 taccagacta ttcagggctg cttaccttga atatgaacct tgcccccccg gttgctccaa
     6361 atttccctgg tgaacaatta ttattcttca gatcttttgt gccatgctca ggaggttata
     6421 accaaggcat tgtagattgt cttatacccc aagaatggat ccaacacttc tatcaggaat
     6481 cagcgccctc ccagtcagac gtggccctaa tcaggtatgt taaccccgac acgggacgta
     6541 cactgtttga agcaaaattg cacagatctg gttacattac tgtggctcac tctggagact
     6601 atcctcttgt tgttccggct aatggatact ttagatttga ttcttgggta aatcagtttt
     6661 actcactcgc cccaatggga actgggaatg ggcgaaggag ggctcagtaa tggctggagc
     6721 tttcattgca ggattggcag gcgacatgct cacgtcatct gtgggctccc tggtgaacgc
     6781 aggggcaaac gccatcaacc aaaagataga ctttgaaaac aacaaacaac tccagtctgc
     6841 ttcctttcag catgatgaag agatgctcca agcgcaggtg aaggcaacca agcagctgca
     6901 atctgaaatg atagccctaa aacagggggt tttggccgca ggcggctttt cccccactga
     6961 tgcagcaagg ggggccattg gtgcacccat gacaaaggtg cttgactggt ctggcactcg
     7021 atactgggca cccaattcca caaagacaac tggttattcg ggacaattca cctcttcacc
     7081 tgtgcgcatg cctagcccaa atgctccaca atcaaaacct gcaaagccta ggtctctagc
     7141 tccttcttct tcttctagta gtgtctatag tatgtctact caatcaactc atttaacatc
     7201 tggctcttct agtaatgctt cttctgcctc tacaaaattg acaaacttaa gctctggctc
     7261 ctctcaaaac agaacagcag agtgggtgga ccaacagaga agtcttagcc ctttcatgag
     7321 tggcgcactc aatatctcac atgtcacgcc accctcaagt agggcttcca gttccgggac
     7381 ggtctcgacc gtgcccaagg aagttttgga ctcctggacg tctgcgttta acacacacag
     7441 acagccgctc ttcgcacacc tcagagtgag gggggagtca cgtgtttagt gaaaagaaat
     7501 aattggctat aatgtgattt ctttttaaaa tttggctaat ttgtatcttt taaaaaaaaa
     7561 taaaaaaaaa aaaaaaaagt tccaaagcca taacctcatt g
//