Typing tool

Complete norovirus genomes

MK073893  GI.3
 GI.P13

Length: 7,678 | 3 CDS

ORF1: 82..5397
ORF2: 5381..7015
ORF3: 7015..7662
LOCUS       MK073893                7678 bp    RNA     linear   VRL 07-FEB-2019
DEFINITION  Norovirus GI.3 isolate Hu/USA/2016/GI.Pd-GI.3/Nashville-0047
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK073893
VERSION     MK073893.1
DBLINK      BioProject: PRJNA322324
KEYWORDS    .
SOURCE      Norovirus GI.3
  ORGANISM  Norovirus GI.3
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7678)
  AUTHORS   Steece,R., Moore,C., Britt,N., Kellem,R., Marine,R. and Castro,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2018) Polio and Picornavirus Laboratory Branch,
            Centers for Disease Control and Prevention, 1600 Clifton Rd. NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7678
                     /organism="Norovirus GI.3"
                     /mol_type="genomic RNA"
                     /isolate="Hu/USA/2016/GI.Pd-GI.3/Nashville-0047"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:647516"
                     /country="USA: TN, Nashville"
                     /collection_date="03-Apr-2016"
                     /note="genotype: GI.Pd-GI.3"
     gene            82..5397
                     /gene="ORF1"
     CDS             82..5397
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZJ17765.1"
                     /translation="MAKIRGRIGPQRGETTTKIKDANMALDLLRRSQTPSPCRQTNNS
                     APKAQRDRPPRTASEVKRALGWDAEPEHQESTARAWCDLSKEEKEEIIRNNERLFDAG
                     GVTPSTLPSTFERTDSNSVTDEQQPVTWSSNGGVDLGINELTTVRGPFWNMCPLPPLE
                     ARNSGPAKEPLIGDMVEFYEGHIFHYAIYIGQGKTIGVHSPQAAFSIPRITIHPLVAW
                     WRVCYIPTSQQRLTYEQLKELENEPWPYASITNNCYEFCCKVMALDDTWLQRRLVTSG
                     KFNHPTQDWSQDTPDFHQDSKLEMVRDAVLSAINGLVSQPFKNILSKIKPLNVLNLLS
                     NCDWTFMGVVELVVLLAELFDVFWTPPDISSFIASLLPDFHLQGPEDLARDLVPLILG
                     GIGLAIGFTRDKITKVMKSAVDGLRSATQLGQYGLEIFSIIKKYFFGGDQTEKTLRGI
                     EDAVIDMEVLSSTNVTQLVKDKKLAKAYMNVLDNEEEKARKLSVRSADPHIVTSVNNL
                     ISRISMARSALAKAQAELTSRPRPVVIMMCGPPGIGKTKAAEHLAGRLAAEIRPGGKV
                     GLVPRESIDHWDGYHGEDVLLWDDYGMSKITEDCNKLQAIADTAPLSLNCDRIENKGM
                     QFSSDAIIITTNAPGPAPVDFVNLGPVCRRVDFLVYCSAPEIEQTRRAHPGDTNAIKD
                     LFKKDFSHLKMELAPQGGFDSQGNTPFGKGVMKTTTLNRLLIQATALAMERQDEFQLQ
                     GAVYNFDEDRVAAFTNLARANGLGLISMATLGKKLRSVKSMEGLRNALLGYKIGECDI
                     IWNTRVYSVKSDGSNVTIKEKQAPSSPQHQAISTATLALSRLRAARALAYASCLQSAV
                     LSILQVAGSALVVSRAVKRMFGTRTEQPILEGKHKEHNCRIHRAEAAGHGPIGHDGII
                     ERYGLCESEQEGEDDQTVELPTADKEGKNKGKTKKGRGRKSNFNAFSRRGLSDEEYEE
                     YKKVREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDGGIGETEAEIRHRVFYKSKSGL
                     RKQRQEERRQLGLVSGTEIRKRKPIDWTPPKNDWSEDTRTVNYDEHISFEAPPSIWSR
                     VVKFGSGWGFWVSSTVFITTTHVIPPGAKEIFGENISNIAIHRVGEFTQFRFSKKMRP
                     DLSGMVLEEGCPEGTVCTIMIKRDSGELLPLAVRMGAVASMKIQGKLMHGQSGMLLTG
                     ANAKGMDLGTIPGDCGAPYIHKRGNDWVVCGVHAAATKSGNTVVCAIQGGEGEATLEG
                     GDQNKGHYAGHPILRYGSGPSLSTKTKFWKSNPQPLPPGTYEPAYLGGRDPRVEGGPS
                     LQQVLRDQLKPFAEPRGRLPEAGLLEAAVETVTNAIEQVMDTPVAWSYGDACMSLDKT
                     TSSGYPHHKRKNDDWNGSSFVRELGDQAAHANSMYELGKSMKPVYTAALKDELVKPDK
                     VYNKIKKRLLWGADLGTVIRAARAFGPFCEAIKPHVIKLPIKVGMNAIEDGPLIYAEH
                     SKYKYHFDADYTAWDSTQNREIMMESFNIMCKLTANPSLAAVVAQDLLSPSEMDVGDY
                     VISVKDGLPSGFPCTSQVNSINHWIYTLCALSEVTGLAPDVIQSQSYFSFYGDDEIVS
                     TDIEFDSNRLTQVLKEYGLKPTRPDKTDGPIIVRQQVDGLVFLRRTISKDAIGYQGRL
                     DRNSIERQLWWTRGPNHDDPFETLVPHTQRKVQLISLLGEAALHGEKFYRKIASRVIQ
                     EVKEGGLEIYIPGWQAMFRWMRFHDLSLWTGDRDLLPDYVNDDGV"
     mat_peptide     82..1212
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1213..2301
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2302..2901
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2902..3321
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3322..3864
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3865..5394
                     /gene="ORF1"
                     /product="RdRp"
     gene            5381..7015
                     /gene="ORF2"
     CDS             5381..7015
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AZJ17766.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEANTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVKVLLAGNAFTAGKIIISCIPPGFVSQNISIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDNTPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFL
                     FLVPPNVEQKTKPFSVPDLPLNVLSNSRVPSLIKFMMVSQDHGQMVQFQNGRVTLDGQ
                     LQGTTPTSASQLCKMRGTVYHASGGQGLNLTEIDGTPYHAFESPAPIGFPDIGDSDWH
                     INASPATAFGSGESVKRLDMEQGSSFAPHLGTVHYTNASYEANADLICSLEWLSPPSG
                     GTPNKVNPWAIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIANGQDGLRVPCT
                     IPQEFVTHFVNEQAPTRGEAALLHYVDPDTHRNLGEFKLYPEGFMTCVPNSSGSGPQT
                     LPINGVFTFVSWVSRFYQLKPVGTTGPVRRLGIRRS"
     gene            7015..7662
                     /gene="ORF3"
     CDS             7015..7662
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AZJ17767.1"
                     /translation="MAQAIFGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQSN
                     TFKHDKEMLGLQVGASTALLQNSLNTRYNMLTNAGLSSSDAARVVVGAPATRVVDWNG
                     TRVSAPQSTATTLRSGGFMTIPTLYKGKQQQKAPTEIGLSNPNYGSSVSSRVADWVSS
                     QNSSRSSLGPYHPSALQTTWVTPPGSSSTSTISSVSTAPRYFNTDRLPLFANMRK"
ORIGIN      
        1 gcgtctaacg acgctattgc cgttgctgat gtcagcaata acaatgctaa caccaacaat
       61 gaaaatatag gatctcgcct tatggcaaag atccgtgggc gcataggccc acaacgtggt
      121 gaaacaacca caaagatcaa agatgccaac atggcgctcg accttttacg ccggtcacaa
      181 acaccatctc catgtcggca aactaataac agcgccccca aggctcaaag ggaccgtccc
      241 ccgcggaccg cttcagaggt aaaaagggcg ctggggtggg atgctgaacc agaacaccaa
      301 gaaagcacgg ctagggcatg gtgtgacctc tcaaaagagg agaaggaaga gataatacgt
      361 aacaatgaga ggctttttga tgctggaggt gtcactccat cgaccctgcc cagcacattt
      421 gagaggactg attcaaacag tgtcactgac gagcaacaac ctgtgacatg gtcttctaat
      481 ggaggggttg accttggcat caatgaattg accacagttc gtggcccgtt ttggaatatg
      541 tgccccctcc caccactaga agcccgcaat agtggccctg ctaaggaacc ccttataggt
      601 gacatggtcg agttctatga aggacacata ttccattatg ccatttacat tgggcagggc
      661 aaaactattg gagtccactc accacaggct gctttttcca tacccagaat aaccatccac
      721 ccactggtgg cctggtggcg tgtgtgttac atccccacta gccaacaacg ccttacctac
      781 gaacagctta aggagttgga gaatgaacca tggccttatg cctcaatcac caacaactgt
      841 tatgagtttt gctgtaaagt gatggcactt gatgatacct ggctccaaag aagactggtt
      901 actagtggaa aatttaacca ccccacacag gactggtcac aggacacccc agatttccat
      961 caggattcga agcttgaaat ggtaagggac gctgtcttgt cggccatcaa cggtcttgta
     1021 tcacaaccct tcaagaacat cctgtctaaa attaaaccat taaatgtgct taatctttta
     1081 tcaaactgtg attggacctt catgggcgtc gtggaactgg tagtgctcct ggcagaactg
     1141 tttgatgtgt tctggacccc accagacatt tcaagcttca ttgcatcttt actacctgat
     1201 tttcatctac aaggcccaga agacctagcc agggacttag ttcccctcat attaggtggc
     1261 ataggcttag caattggttt tacaagagac aaaataacaa aagtgatgaa gagcgccgtt
     1321 gatggactgc ggtcagcaac gcagctcgga caatatggac tggagatatt ctcaattatc
     1381 aagaaatact tctttggagg ggaccaaaca gaaaagaccc tgcggggcat tgaagatgcg
     1441 gtgatagaca tggaagtgtt gtccagtacc aatgtgacgc aactggtcaa agataagaag
     1501 ttagccaaag cttacatgaa tgtactggac aatgaggagg aaaaagcaag gaagctctca
     1561 gtccgtagtg ctgacccaca tatagtgacc tctgtcaaca acttgatatc acgcatctct
     1621 atggcaagat cagctctagc taaagcccaa gctgagttga cgtcccgccc acgaccagtg
     1681 gttataatga tgtgtggtcc tcctggcatc ggaaagacta aggccgctga gcacctagcc
     1741 ggccggctag ctgctgaaat cagacctgga ggtaaagttg gccttgtacc ccgggagtcc
     1801 atagaccatt gggatggata tcatggcgag gacgtcttgc tctgggatga ctatggcatg
     1861 tcaaagataa cagaggattg taataagtta caggctatag ctgatactgc accactgtca
     1921 cttaattgtg acagaataga aaacaaaggc atgcaattct cttctgatgc aataattata
     1981 accaccaatg cccctggccc agccccagtt gactttgtca acttaggccc cgtgtgcaga
     2041 cgagtggact ttttagttta ctgttctgca cccgagattg aacaaacgcg gagggctcat
     2101 ccaggtgaca ccaatgccat caaggatctg tttaaaaagg acttctcaca cttgaaaatg
     2161 gaactggctc cacagggcgg ctttgatagt cagggcaaca caccttttgg gaagggtgtc
     2221 atgaaaacca caactctcaa taggctactg atacaggcca cagcattagc catggagcga
     2281 caagatgaat tccaactcca gggggctgtc tacaactttg acgaggatag agtggccgcc
     2341 ttcaccaatc tagctcgagc taatggcctg gggcttataa gtatggcaac attaggcaag
     2401 aagctgagaa gtgttaagtc catggaaggc ttgcgcaatg cactactggg atacaagatt
     2461 ggagaatgtg atataatctg gaacaccagg gtgtattcag ttaagagtga cgggagcaat
     2521 gtcacaatca aagaaaagca ggcaccgtcc tcaccccaac atcaagctat ttccacagcc
     2581 accctggcgc tctctagact gcgggctgcc agagcccttg cgtatgcttc ctgtttacaa
     2641 agtgcagtgt tgtcaatact tcaggttgcc ggctctgcct tagtggtgag cagggctgta
     2701 aaacgcatgt ttggcacacg caccgaacag cccattttgg agggtaagca taaagaacac
     2761 aactgcagga tacaccgtgc agaggccgcc ggtcatggcc ccattggtca tgatggaatc
     2821 attgaacgtt atggtctgtg tgagagtgag caggaaggag aagatgacca aactgtggag
     2881 ctgcccactg ctgacaaaga aggcaagaac aaaggcaaga ccaaaaaggg ccgcggacgg
     2941 aaatccaact tcaatgcatt ctctaggcgt ggacttagtg atgaggaata cgaggagtac
     3001 aagaaagtaa gagaagagaa gggtggcaac tacagcatac aagagtacct tgaggaccgc
     3061 cagcgctatg aagaagaact cgctgaggtg caagctggtg gagatggtgg aatcggcgaa
     3121 actgaagctg agatccgcca ccgcgttttc tataaatcaa agtctggctt gagaaaacag
     3181 cggcaagagg aacgccgcca gttaggcctc gtgagcggta ctgaaatccg caaacgcaaa
     3241 cccatagact ggaccccccc caaaaatgat tggtcagagg acactagaac tgttaattat
     3301 gatgaacaca tcagctttga agccccccct tcaatctgga gtagagtagt taaatttggc
     3361 agtggctggg gtttttgggt gagttcaaca gtgttcatca ccacaacaca tgttatacca
     3421 cctggtgcta aagagatctt tggtgagaac attagcaata ttgccatcca tagagttggc
     3481 gaattcaccc aattccgttt ctccaagaaa atgaggcctg acctctctgg catggtcctg
     3541 gaagagggat gccctgaggg cacagtgtgc accataatga taaaaagaga ctctggagag
     3601 ctgttgccgc tggctgttcg tatgggagca gtggcctcaa tgaagatcca agggaagctt
     3661 atgcatggac agtcagggat gttgctcacc ggtgctaacg ccaagggcat ggaccttggt
     3721 accatacctg gggattgtgg agcgccctat atccacaaga gagggaatga ctgggtggtt
     3781 tgtggggtgc atgcagcagc cacgaaatca ggcaataccg tggtgtgcgc catacaaggt
     3841 ggtgaaggtg aagccacgct agagggtggc gatcaaaata agggtcatta tgcaggacac
     3901 ccaatactaa gatatggtag tggcccttca ttgtcaacta aaacaaagtt ttggaaatca
     3961 aacccccaac ctctaccccc tggtacatat gaaccagcct acctcggtgg cagagacccc
     4021 agggttgaag gtggtccatc tttgcagcaa gtattgcgag accagctaaa accatttgct
     4081 gagccccgtg gcaggttgcc tgaagcagga ctgctagaag ccgcggttga aactgtcacc
     4141 aatgcaattg aacaggtcat ggacacacct gtggcatgga gttacggcga cgcctgcatg
     4201 tccttggaca aaacaaccag ttctggctac cctcatcaca aaagaaagaa tgatgactgg
     4261 aacgggagtt catttgtgag agaattggga gaccaggcag cgcatgctaa tagcatgtat
     4321 gagcttggta aatctatgaa accagtgtac acagcagcac tcaaggatga gcttgttaag
     4381 ccagacaagg tgtacaataa aattaagaaa aggctactct ggggggcgga cctcggcacc
     4441 gtcatacgtg ctgctagggc ttttgggcca ttttgtgaag caataaagcc ccatgtgatt
     4501 aagttaccca ttaaagtggg catgaatgcc atagaagatg gacccttaat ttatgcagaa
     4561 cactccaaat ataagtatca ttttgatgct gattacacag catgggactc aacacaaaat
     4621 agggagatta tgatggagtc ctttaacatc atgtgtaaac tcaccgctaa tccctccctg
     4681 gccgcagtgg tggcacagga cctgctctct ccttctgaga tggatgtcgg cgattatgtg
     4741 atcagtgtca aagatggcct accatctggc tttccatgca cctcacaagt gaacagtatc
     4801 aaccattgga tctacacttt gtgcgcctta tcagaggtta ctggtttggc tcctgacgta
     4861 atacagtcac agtcttactt ttcattttat ggtgatgatg aaatagtttc aacagatatt
     4921 gaatttgact caaacagatt aacacaggtg ctaaaagagt atggcttaaa acccacaaga
     4981 cctgataaaa ctgatggtcc gatcattgta aggcaacagg ttgatggctt ggttttcctt
     5041 cggcgcacca tctcgaagga tgccatcggg taccagggtc ggcttgatcg caattccatt
     5101 gaaagacagc tctggtggac ccgagggccc aatcatgatg atccatttga aaccttggtc
     5161 ccacacacac agaggaaggt ccaattaata tccctattag gtgaggccgc actccatggt
     5221 gagaaattct atagaaagat agccagtagg gtgatccagg aggttaaaga aggaggattg
     5281 gaaatttaca tccctgggtg gcaggccatg ttccgctgga tgcgattcca tgatttgagt
     5341 ttgtggacag gagaccgcga tctcctgccc gattatgtaa atgatgatgg cgtctaagga
     5401 cgccccaaca aacatggatg gcaccagtgg tgccggccag ctggtaccag aggcaaatac
     5461 agctgagcct atatcaatgg agccagtggc tggggcagcg acagctgccg caaccgctgg
     5521 tcaagttaat atgattgacc cctggattat gaataattat gtgcaagccc cacaaggtga
     5581 attcaccata tcaccaaaca acacaccagg tgatattcta tttgatttac aattaggccc
     5641 tcacctcaac ccctttttat cccatttggc tcaaatgtac aatggatggg taggtaacat
     5701 gaaagtgaaa gttttattgg caggtaatgc tttcacggca ggaaaaatta ttattagttg
     5761 tataccccct ggttttgtct cacagaatat atctatagct caagctacaa tgttccccca
     5821 cgttatagct gatgtcaggg tcctggagcc cattgaggtc ccattggagg atgtgaggaa
     5881 tgtgttgttc cacaataacg ataacacacc aaccatgaga ctggtatgca tgctctacac
     5941 ccccttgcgt gccagcggaa gctcatctgg gacagacccc tttgtgattg ctgggcgtgt
     6001 gttgacttgc cctagtcctg attttagctt cttattctta gtgcccccca atgtagaaca
     6061 aaagactaaa ccttttagtg tcccagatct cccactcaat gttctatcaa attcaagggt
     6121 gccgtcactg ataaaattca tgatggtgtc acaggaccac ggacagatgg tacaatttca
     6181 gaatggcagg gtcacactgg atggacagct ccagggcacc acaccaacat cggccagcca
     6241 gctctgcaag atgcggggga cggtttacca tgcctccggt ggtcaagggc tcaatttaac
     6301 tgagattgat ggcaccccct atcatgcatt tgaaagccca gctcccattg gtttccctga
     6361 cataggagac agcgattggc acatcaacgc ttcacccgcc accgccttcg gcagtggcga
     6421 aagcgtcaaa agactagata tggaacaggg ctcttcattt gccccacatt tgggtactgt
     6481 acactatact aatgccagct atgaagccaa tgctgatttg atctgctcat tggagtggct
     6541 atccccgcct agcggaggca ctccaaacaa agtcaatcct tgggccatcc cacggtatgg
     6601 ttcaactttg actgaagctg ctcagctggc cccaccaatt tacccccctg gctttggaga
     6661 agctatagtt ttctttatgt ctgactttcc tatagcaaat ggtcaagatg ggttaagagt
     6721 gccctgcact ataccccaag aatttgtaac ccattttgtc aatgaacaag caccaacccg
     6781 tggggaagct gcccttcttc attatgttga tcccgacaca caccgcaatt tgggtgagtt
     6841 taagttatac cctgaaggat ttatgacttg tgtaccaaat tccagtggta gtggtcccca
     6901 aacgctgcct atcaatggag tcttcacttt tgtctcttgg gtttctcgtt tctatcaact
     6961 aaagcctgtg ggaacgaccg gaccggttcg taggctagga atcaggagat cataatggcc
     7021 caggcaatat ttggagcaat agctgcgacg gctgctggta gcgctgtggg tgcaggcatt
     7081 caggctggta ctgaggccgc actccaacat cagcggttcc agcaggattt aacgttgcag
     7141 agcaacactt tcaaacatga caaagaaatg ctagggctac aggttggtgc ttccactgct
     7201 ctcttgcaaa acagcctcaa cacccgctac aacatgctca caaatgctgg cctctcgtcc
     7261 tcagatgcag cacgcgtggt ggttggcgcg ccagccacac gtgttgttga ctggaacggc
     7321 accagggtgt cagcaccaca atctacagct accacgttga ggtctggtgg gttcatgaca
     7381 atcccaactc tgtacaaggg caaacaacag caaaaagctc caactgaaat tggcttgtct
     7441 aacccaaatt atggctcatc tgtgtcttct agggttgctg attgggtttc ctctcaaaat
     7501 tcttctcgct catccttggg cccgtatcac cccagtgctt tgcagacaac atgggtgacc
     7561 ccacccggtt ctagttctac ttctactatt tcttctgtgt ctactgcacc tagatatttc
     7621 aatactgata ggttgcctct attcgcaaat atgaggaagt aatttttgta atatgaaa
//