Typing tool

Complete norovirus genomes

MK073892  GI.3
 GI.P13

Length: 7,692 | 3 CDS

ORF1: 91..5406
ORF2: 5390..7024
ORF3: 7024..7671
LOCUS       MK073892                7692 bp    RNA     linear   VRL 07-FEB-2019
DEFINITION  Norovirus GI.3 isolate Hu/USA/2016/GI.Pd-GI.3/Nashville-0046
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK073892
VERSION     MK073892.1
DBLINK      BioProject: PRJNA322324
KEYWORDS    .
SOURCE      Norovirus GI.3
  ORGANISM  Norovirus GI.3
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7692)
  AUTHORS   Steece,R., Moore,C., Britt,N., Kellem,R., Marine,R. and Castro,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2018) Polio and Picornavirus Laboratory Branch,
            Centers for Disease Control and Prevention, 1600 Clifton Rd. NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7692
                     /organism="Norovirus GI.3"
                     /mol_type="genomic RNA"
                     /isolate="Hu/USA/2016/GI.Pd-GI.3/Nashville-0046"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:647516"
                     /country="USA: TN, Nashville"
                     /collection_date="02-Apr-2016"
                     /note="genotype: GI.Pd-GI.3"
     gene            91..5406
                     /gene="ORF1"
     CDS             91..5406
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZJ17762.1"
                     /translation="MAKIRGRIGPQRGETTTKIKDANMALDLLRRSQTPSPCRQTNNS
                     APKAQRDRPPRTASEVKRALGWDAEPEHQESTARAWCDLSKEEKEEIIRNNERLFDAG
                     GVTPSTLPSTFERTDSNSVTDEQQPVTWSSNGGVDLGINELTTVRGPFWNMCPLPPLE
                     ARNSGPAKEPLIGDMVEFYEGHIFHYAIYIGQGKTIGVHSPQAAFSIPRITIHPLVAW
                     WRVCYIPTSQQRLTYEQLKELENEPWPYASITNNCYEFCCKVMALDDTWLQRRLVTSG
                     KFNHPTQDWSQDTPDFHQDSKLEMVRDAVLSAINGLVSQPFKNILSKIKPLNVLNLLS
                     NCDWTFMGVVELVVLLAELFDVFWTPPDISSFIASLLPDFHLQGPEDLARDLVPLILG
                     GIGLAIGFTRDKITKVMKSAVDGLRSATQLGQYGLEIFSIIKKYFFGGDQTEKTLRGI
                     EDAVIDMEVLSSTNVTQLVKDKKLAKAYMNVLDNEEEKARKLSVRSADPHIVTSVNNL
                     ISRISMARSALAKAQAELTSRPRPVVIMMCGPPGIGKTKAAEHLAGRLAAEIRPGGKV
                     GLVPRESIDHWDGYHGEDVLLWDDYGMSKITEDCNKLQAIADTAPLSLNCDRIENKGM
                     QFSSDAIIITTNAPGPAPVDFVNLGPVCRRVDFLVYCSAPEIEQTRRAHPGDTNAIKD
                     LFKKDFSHLKMELAPQGGFDSQGNTPFGKGVMKTTTLNRLLIQATALAMERQDEFQLQ
                     GAVYNFDEDRVAAFTNLARANGLGLISMATLGKKLRSVKSMEGLRNALLGYKIGECDI
                     IWNTRVYSVKSDGSNVTIKEKQAPSSPQHQAISTATLALSRLRAARALAYASCLQSAV
                     LSILQVAGSALVVSRAVKRMFGTRTEQPILEGKHKEHNCRIHRAEAAGHGPIGHDGII
                     ERYGLCESEQEGEDDQTVELPTADKEGKNKGKTKKGRGRKSNFNAFSRRGLSDEEYEE
                     YKKVREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDGGIGETEAEIRHRVFYKSKSGL
                     RKQRQEERRQLGLVSGTEIRKRKPIDWTPPKNDWSEDTRTVNYDEHISFEAPPSIWSR
                     VVKFGSGWGFWVSSTVFITTTHVIPPGAKEIFGENISNIAIHRVGEFTQFRFSKKMRP
                     DLSGMVLEEGCPEGTVCTIMIKRDSGELLPLAVRMGAVASMKIQGKLMHGQSGMLLTG
                     ANAKGMDLGTIPGDCGAPYIHKRGNDWVVCGVHAAATKSGNTVVCAIQGGEGEATLEG
                     GDQNKGHYAGHPILRYGSGPSLSTKTKFWKSNPQPLPPGTYEPAYLGGRDPRVEGGPS
                     LQQVLRDQLKPFAEPRGRLPEAGLLEAAVETVTNAIEQVMDTPVAWSYGDACMSLDKT
                     TSSGYPHHKRKNDDWNGSSFVRELGDQAAHANSMYELGKSMKPVYTAALKDELVKPDK
                     VYNKIKKRLLWGADLGTVIRAARAFGPFCEAIKPHVIKLPIKVGMNAIEDGPLIYAEH
                     SKYKYHFDADYTAWDSTQNREIMMESFNIMCKLTANPSLAAVVAQDLLSPSEMDVGDY
                     VISVKDGLPSGFPCTSQVNSINHWIYTLCALSEVTGLAPDVIQSQSYFSFYGDDEIVS
                     TDIEFDSNRLTQVLKEYGLKPTRPDKTDGPIIVRQQVDGLVFLRRTISKDAIGYQGRL
                     DRNSIERQLWWTRGPNHDDPFETLVPHTQRKVQLISLLGEAALHGEKFYRKIASRVIQ
                     EVKEGGLEIYIPGWQAMFRWMRFHDLSLWTGDRDLLPDYVNDDGV"
     mat_peptide     91..1221
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1222..2310
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2311..2910
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2911..3330
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3331..3873
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3874..5403
                     /gene="ORF1"
                     /product="RdRp"
     gene            5390..7024
                     /gene="ORF2"
     CDS             5390..7024
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AZJ17763.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEANTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVKVLLAGNAFTAGKIIISCIPPGFVSQNISIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDNTPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFL
                     FLVPPNVEQKTKPFSVPDLPLNVLSNSRVPSLIKFMMVSQDHGQMVQFQNGRVTLDGQ
                     LQGTTPTSASQLCKMRGTVYHASGGQGLNLTEIDGTPYHAFESPAPIGFPDIGDSDWH
                     INASPATAFGSGESVKRLDMEQGSSFAPHLGTVHYTNASYEANADLICSLEWLSPPSG
                     GTPNKVNPWAIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIANGQDGLRVPCT
                     IPQEFVTHFVNEQAPTRGEAALLHYVDPDTHRNLGEFKLYPEGFMTCVPNSSGSGPQT
                     LPINGVFTFVSWVSRFYQLKPVGTTGPVRRLGIRRS"
     gene            7024..7671
                     /gene="ORF3"
     CDS             7024..7671
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AZJ17764.1"
                     /translation="MAQAIFGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQSN
                     TFKHDKEMLGLQVGASTALLQNSLNTRYNMLTNAGLSSSDAARVVVGAPATRVVDWNG
                     TRVSAPQSTATTLRSGGFMTIPTLYKGKQQQKAPTEIGLSNPNYGSSVSSRVADWVSS
                     QNSSRSSLGPYHPSALQTTWVTPPGSSSTSTISSVSTAPRYFNTDRLPLFANMRK"
ORIGIN      
        1 atgatgatgg cgtctaacga cgctattgcc gttgctgatg tcagcaataa caatgctaac
       61 accaacaatg aaaatatagg atctcgcctt atggcaaaga tccgtgggcg cataggccca
      121 caacgtggtg aaacaaccac aaagatcaaa gatgccaaca tggcgctcga ccttttacgc
      181 cggtcacaaa caccatctcc atgtcggcaa actaataaca gcgcccccaa ggctcaaagg
      241 gaccgtcccc cgcggaccgc ttcagaggta aaaagggcgc tggggtggga tgctgaacca
      301 gaacaccaag aaagcacggc tagggcatgg tgtgacctct caaaagagga gaaggaagag
      361 ataatacgta acaatgagag gctttttgat gctggaggtg tcactccatc gaccctgccc
      421 agcacatttg agaggactga ttcaaacagt gtcactgacg agcaacaacc tgtgacatgg
      481 tcttctaatg gaggggttga ccttggcatc aatgaattga ccacagttcg tggcccgttt
      541 tggaatatgt gccccctccc accactagaa gcccgcaata gtggccctgc taaggaaccc
      601 cttataggtg acatggtcga gttctatgaa ggacacatat tccattatgc catttacatt
      661 gggcagggca aaactattgg agtccactca ccacaggctg ctttttccat acccagaata
      721 accatccacc cactggtggc ctggtggcgt gtgtgttaca tccccactag ccaacaacgc
      781 cttacctacg aacagcttaa ggagttggag aatgaaccat ggccttatgc ctcaatcacc
      841 aacaactgtt atgagttttg ctgtaaagtg atggcacttg atgatacctg gctccaaaga
      901 agactggtta ctagtggaaa atttaaccac cccacacagg actggtcaca ggacacccca
      961 gatttccatc aggattcgaa gcttgaaatg gtaagggacg ctgtcttgtc ggccatcaac
     1021 ggtcttgtat cacaaccctt caagaacatc ctgtctaaaa ttaaaccatt aaatgtgctt
     1081 aatcttttat caaactgtga ttggaccttc atgggcgtcg tggaactggt agtgctcctg
     1141 gcagaactgt ttgatgtgtt ctggacccca ccagacattt caagcttcat tgcatcttta
     1201 ctacctgatt ttcatctaca aggcccagaa gacctagcca gggacttagt tcccctcata
     1261 ttaggtggca taggcttagc aattggtttt acaagagaca aaataacaaa agtgatgaag
     1321 agcgccgttg atggactgcg gtcagcaacg cagctcggac aatatggact ggagatattc
     1381 tcaattatca agaaatactt ctttggaggg gaccaaacag aaaagaccct gcggggcatt
     1441 gaagatgcgg tgatagacat ggaagtgttg tccagtacca atgtgacgca actggtcaaa
     1501 gataagaagt tagccaaagc ttacatgaat gtactggaca atgaggagga aaaagcaagg
     1561 aagctctcag tccgtagtgc tgacccacat atagtgacct ctgtcaacaa cttgatatca
     1621 cgcatctcta tggcaagatc agctctagct aaagcccaag ctgagttgac gtcccgccca
     1681 cgaccagtgg ttataatgat gtgtggtcct cctggcatcg gaaagactaa ggccgctgag
     1741 cacctagccg gccggctagc tgctgaaatc agacctggag gtaaagttgg ccttgtaccc
     1801 cgggagtcca tagaccattg ggatggatat catggcgagg acgtcttgct ctgggatgac
     1861 tatggcatgt caaagataac agaggattgt aataagttac aggctatagc tgatactgca
     1921 ccactgtcac ttaattgtga cagaatagaa aacaaaggca tgcaattctc ttctgatgca
     1981 ataattataa ccaccaatgc ccctggccca gccccagttg actttgtcaa cttaggcccc
     2041 gtgtgcagac gagtggactt tttagtttac tgttctgcac ccgagattga acaaacgcgg
     2101 agggctcatc caggtgacac caatgccatc aaggatctgt ttaaaaagga cttctcacac
     2161 ttgaaaatgg aactggctcc acagggcggc tttgatagtc agggcaacac accttttggg
     2221 aagggtgtca tgaaaaccac aactctcaat aggctactga tacaggccac agcattagcc
     2281 atggagcgac aagatgaatt ccaactccag ggggctgtct acaactttga cgaggataga
     2341 gtggccgcct tcaccaatct agctcgagct aatggcctgg ggcttataag tatggcaaca
     2401 ttaggcaaga agctgagaag tgttaagtcc atggaaggct tgcgcaatgc actactggga
     2461 tacaagattg gagaatgtga tataatctgg aacaccaggg tgtattcagt taagagtgac
     2521 gggagcaatg tcacaatcaa agaaaagcag gcaccgtcct caccccaaca tcaagctatt
     2581 tccacagcca ccctggcgct ctctagactg cgggctgcca gagcccttgc gtatgcttcc
     2641 tgtttacaaa gtgcagtgtt gtcaatactt caggttgccg gctctgcctt agtggtgagc
     2701 agggctgtaa aacgcatgtt tggcacacgc accgaacagc ccattttgga gggtaagcat
     2761 aaagaacaca actgcaggat acaccgtgca gaggccgccg gtcatggccc cattggtcat
     2821 gatggaatca ttgaacgtta tggtctgtgt gagagtgagc aggaaggaga agatgaccaa
     2881 actgtggagc tgcccactgc tgacaaagaa ggcaagaaca aaggcaagac caaaaagggc
     2941 cgcggacgga aatccaactt caatgcattc tctaggcgtg gacttagtga tgaggaatac
     3001 gaggagtaca agaaagtaag agaagagaag ggtggcaact acagcataca agagtacctt
     3061 gaggaccgcc agcgctatga agaagaactc gctgaggtgc aagctggtgg agatggtgga
     3121 atcggcgaaa ctgaagctga gatccgccac cgcgttttct ataaatcaaa gtctggcttg
     3181 agaaaacagc ggcaagagga acgccgccag ttaggcctcg tgagcggtac tgaaatccgc
     3241 aaacgcaaac ccatagactg gacccccccc aaaaatgatt ggtcagagga cactagaact
     3301 gttaattatg atgaacacat cagctttgaa gccccccctt caatctggag tagagtagtt
     3361 aaatttggca gtggctgggg tttttgggtg agttcaacag tgttcatcac cacaacacat
     3421 gttataccac ctggtgctaa agagatcttt ggtgagaaca ttagcaatat tgccatccat
     3481 agagttggcg aattcaccca attccgtttc tccaagaaaa tgaggcctga cctctctggc
     3541 atggtcctgg aagagggatg ccctgagggc acagtgtgca ccataatgat aaaaagagac
     3601 tctggagagc tgttgccgct ggctgttcgt atgggagcag tggcctcaat gaagatccaa
     3661 gggaagctta tgcatggaca gtcagggatg ttgctcaccg gtgctaacgc caagggcatg
     3721 gaccttggta ccatacctgg ggattgtgga gcgccctata tccacaagag agggaatgac
     3781 tgggtggttt gtggggtgca tgcagcagcc acgaaatcag gcaataccgt ggtgtgcgcc
     3841 atacaaggtg gtgaaggtga agccacgcta gagggtggcg atcaaaataa gggtcattat
     3901 gcaggacacc caatactaag atatggtagt ggcccttcat tgtcaactaa aacaaagttt
     3961 tggaaatcaa acccccaacc tctaccccct ggtacatatg aaccagccta cctcggtggc
     4021 agagacccca gggttgaagg tggtccatct ttgcagcaag tattgcgaga ccagctaaaa
     4081 ccatttgctg agccccgtgg caggttgcct gaagcaggac tgctagaagc cgcggttgaa
     4141 actgtcacca atgcaattga acaggtcatg gacacacctg tggcatggag ttacggcgac
     4201 gcctgcatgt ccttggacaa aacaaccagt tctggctacc ctcatcacaa aagaaagaat
     4261 gatgactgga acgggagttc atttgtgaga gaattgggag accaggcagc gcatgctaat
     4321 agcatgtatg agcttggtaa atctatgaaa ccagtgtaca cagcagcact caaggatgag
     4381 cttgttaagc cagacaaggt gtacaataaa attaagaaaa ggctactctg gggggcggac
     4441 ctcggcaccg tcatacgtgc tgctagggct tttgggccat tttgtgaagc aataaagccc
     4501 catgtgatta agttacccat taaagtgggc atgaatgcca tagaagatgg acccttaatt
     4561 tatgcagaac actccaaata taagtatcat tttgatgctg attacacagc atgggactca
     4621 acacaaaata gggagattat gatggagtcc tttaacatca tgtgtaaact caccgctaat
     4681 ccctccctgg ccgcagtggt ggcacaggac ctgctctctc cttctgagat ggatgtcggc
     4741 gattatgtga tcagtgtcaa agatggccta ccatctggct ttccatgcac ctcacaagtg
     4801 aacagtatca accattggat ctacactttg tgcgccttat cagaggttac tggtttggct
     4861 cctgacgtaa tacagtcaca gtcttacttt tcattttatg gtgatgatga aatagtttca
     4921 acagatattg aatttgactc aaacagatta acacaggtgc taaaagagta tggcttaaaa
     4981 cccacaagac ctgataaaac tgatggtccg atcattgtaa ggcaacaggt tgatggcttg
     5041 gttttccttc ggcgcaccat ctcgaaggat gccatcgggt accagggtcg gcttgatcgc
     5101 aattccattg aaagacagct ctggtggacc cgagggccca atcatgatga tccatttgaa
     5161 accttggtcc cacacacaca gaggaaggtc caattaatat ccctattagg tgaggccgca
     5221 ctccatggtg agaaattcta tagaaagata gccagtaggg tgatccagga ggttaaagaa
     5281 ggaggattgg aaatttacat ccctgggtgg caggccatgt tccgctggat gcgattccat
     5341 gatttgagtt tgtggacagg agaccgcgat ctcctgcccg attatgtaaa tgatgatggc
     5401 gtctaaggac gccccaacaa acatggatgg caccagtggt gccggccagc tggtaccaga
     5461 ggcaaataca gctgagccta tatcaatgga gccagtggct ggggcagcga cagctgccgc
     5521 aaccgctggt caagttaata tgattgaccc ctggattatg aataattatg tgcaagcccc
     5581 acaaggtgaa ttcaccatat caccaaacaa cacaccaggt gatattctat ttgatttaca
     5641 attaggccct cacctcaacc cctttttatc ccatttggct caaatgtaca atggatgggt
     5701 aggtaacatg aaagtgaaag ttttattggc aggtaatgct ttcacggcag gaaaaattat
     5761 tattagttgt ataccccctg gttttgtctc acagaatata tctatagctc aagctacaat
     5821 gttcccccac gttatagctg atgtcagggt cctggagccc attgaggtcc cattggagga
     5881 tgtgaggaat gtgttgttcc acaataacga taacacacca accatgagac tggtatgcat
     5941 gctctacacc cccttgcgtg ccagcggaag ctcatctggg acagacccct ttgtgattgc
     6001 tgggcgtgtg ttgacttgcc ctagtcctga ttttagcttc ttattcttag tgccccccaa
     6061 tgtagaacaa aagactaaac cttttagtgt cccagatctc ccactcaatg ttctatcaaa
     6121 ttcaagggtg ccgtcactga taaaattcat gatggtgtca caggaccacg gacagatggt
     6181 acaatttcag aatggcaggg tcacactgga tggacagctc cagggcacca caccaacatc
     6241 ggccagccag ctctgcaaga tgcgggggac ggtttaccat gcctccggtg gtcaagggct
     6301 caatttaact gagattgatg gcacccccta tcatgcattt gaaagcccag ctcccattgg
     6361 tttccctgac ataggagaca gcgattggca catcaacgct tcacccgcca ccgccttcgg
     6421 cagtggcgaa agcgtcaaaa gactagatat ggaacagggc tcttcatttg ccccacattt
     6481 gggtactgta cactatacta atgccagcta tgaagccaat gctgatttga tctgctcatt
     6541 ggagtggcta tccccgccta gcggaggcac tccaaacaaa gtcaatcctt gggccatccc
     6601 acggtatggt tcaactttga ctgaagctgc tcagctggcc ccaccaattt acccccctgg
     6661 ctttggagaa gctatagttt tctttatgtc tgactttcct atagcaaatg gtcaagatgg
     6721 gttaagagtg ccctgcacta taccccaaga atttgtaacc cattttgtca atgaacaagc
     6781 accaacccgt ggggaagctg cccttcttca ttatgttgat cccgacacac accgcaattt
     6841 gggtgagttt aagttatacc ctgaaggatt tatgacttgt gtaccaaatt ccagtggtag
     6901 tggtccccaa acgctgccta tcaatggagt cttcactttt gtctcttggg tttctcgttt
     6961 ctatcaacta aagcctgtgg gaacgaccgg accggttcgt aggctaggaa tcaggagatc
     7021 ataatggccc aggcaatatt tggagcaata gctgcgacgg ctgctggtag cgctgtgggt
     7081 gcaggcattc aggctggtac tgaggccgca ctccaacatc agcggttcca gcaggattta
     7141 acgttgcaga gcaacacttt caaacatgac aaagaaatgc tagggctaca ggttggtgct
     7201 tccactgctc tcttgcaaaa cagcctcaac acccgctaca acatgctcac aaatgctggc
     7261 ctctcgtcct cagatgcagc acgcgtggtg gttggcgcgc cagccacacg tgttgttgac
     7321 tggaacggca ccagggtgtc agcaccacaa tctacagcta ccacgttgag gtctggtggg
     7381 ttcatgacaa tcccaactct gtacaagggc aaacaacagc aaaaagctcc aactgaaatt
     7441 ggcttgtcta acccaaatta tggctcatct gtgtcttcta gggttgctga ttgggtttcc
     7501 tctcaaaatt cttctcgctc atccttgggc ccgtatcacc ccagtgcttt gcagacaaca
     7561 tgggtgaccc cacccggttc tagttctact tctactattt cttctgtgtc tactgcacct
     7621 agatatttca atactgatag gttgcctcta ttcgcaaata tgaggaagta atttttgtaa
     7681 tatgaaatgt gg
//