Typing tool

Complete norovirus genomes

MK073887  GI.3
 GI.P13

Length: 7,691 | 3 CDS

ORF1: 89..5404
ORF2: 5388..7022
ORF3: 7022..7669
LOCUS       MK073887                7691 bp    RNA     linear   VRL 07-FEB-2019
DEFINITION  Norovirus GI.3 isolate Hu/USA/2016/GI.Pd-GI.3/BayCity-0088
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK073887
VERSION     MK073887.1
DBLINK      BioProject: PRJNA322324
KEYWORDS    .
SOURCE      Norovirus GI.3
  ORGANISM  Norovirus GI.3
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7691)
  AUTHORS   Soehnlen,M., Riner,D., Mosher,L., Vavricka,V., Castro,C.J.,
            Marine,R. and Rodeman,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2018) Polio and Picornavirus Laboratory Branch,
            Centers for Disease Control and Prevention, 1600 Clifton Rd. NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7691
                     /organism="Norovirus GI.3"
                     /mol_type="genomic RNA"
                     /isolate="Hu/USA/2016/GI.Pd-GI.3/BayCity-0088"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:647516"
                     /country="USA: MI, Midland County, Midland"
                     /collection_date="22-Mar-2016"
                     /note="genotype: GI.Pd-GI.3"
     gene            89..5404
                     /gene="ORF1"
     CDS             89..5404
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZJ17747.1"
                     /translation="MAKIRGRIGPQRGETTTKIKDANMALDLLRRSQTPSPCRQTNDS
                     APKAQRDRPPRTASEVRRALGWDAEPEHQESTARAWCDLSKEEKEEIIRNNERLFDAG
                     GVTPSTLPSTFERTDSNSVTDEQQPVTWSSNGGVDLGINELTTVRGPFWNMCPLPPLE
                     ARNSGPAKEPLIGDMVEFYEGHIFHYAIYIGQGKTIGVHSPQAAFSIPRITIHPLVAW
                     WRVCYIPTSQQRLTYEQLKELENEPWPYASITNNCYEFCCKVMALDDTWLQRRLVTSG
                     KFNHPTQDWSQDTPDFHQDSKLEMVRDAVLSAINGLVSQPFKNILSKIKPLNVLNLLS
                     NCDWTFMGVVELVVLLAELFDVFWTPPDISSFIASLLPDFHLQGPEDLARDLVPLILG
                     GIGLAIGFTRDKITKVMKSAVDGLRSATQLGQYGLEIFSIIKKYFFGGDQTEKTLRGI
                     EDAVIDMEVLSSTNVTQLVKDKKLAKAYMNVLDNEEEKARKLSVRSADPHIVTSVNNL
                     ISRISMARSALAKAQAELTSRPRPVVIMMCGPPGIGKTKAAEHLAGRLAAEIRPGGKV
                     GLVPRESIDHWDGYHGEDVLLWDDYGMSKITEDCNKLQAIADTAPLSLNCDRIENKGM
                     QFSSDAIIITTNAPGPAPVDFVNLGPVCRRVDFLVYCSAPEIEQMRRAHPGDTNAIKD
                     LFKKDFSHLKMELAPQGGFDNQGNTPFGKGVMKTTTLNRLLIQATALAMERQDEFQLQ
                     GAVYNFDEDRVAAFTNLARANGLGLISMATLGKKLRSVKSMEGLRNALLGYKIGECDI
                     IWNTRVYSVKSDGSNVTIKEKQAPSSPQHQAISTATLALSRLRAARALAYASCLQSAV
                     LSILQVAGSALVVSRAVKRMFGTRTEQPILEGKHKEHNCRVHRAEAAGHGPIGHDGII
                     ERYGLCESEQEGEDDQTVELPTADKEGKNKGKTKKGRGRKSNFNAFSRRGLSDEEYEE
                     YKKVREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDGGIGETEAEIRHRVFYKSKSGL
                     RKQRQEERRQLGLVSGTEIRKRKPIDWTPPKNDWSEDTRTVNYDEHISFEAPPSIWSR
                     VVKFGSGWGFWVSSTVFITTTHVIPPGAKEIFGENISNIAIHRVGEFTQFRFSKKMRP
                     DLSGMVLEEGCPEGTVCTIMIKRDSGELLPLAVRMGAVASMKIQGKLMHGQSGMLLTG
                     ANAKGMDLGTIPGDCGAPYIHKRGNDWVVCGVHAAATKSGNTVVCAIQGGEGEATLEG
                     GDQNKGHYAGHPILRYGSGPSLSTKTKFWKSNPQPLPPGTYEPAYLGGRDPRVEGGPS
                     LQQVLRDQLKPFAEPRGRLPEAGLLEAAVETVTNAIEQVMDTPVAWSYGDACMSLDKT
                     TSSGYPHHKRKNDDWNGSSFVRELGDQAAHANSMYELGKSMKPVYTAALKDELVKPDK
                     VYNKIKKRLLWGADLGTVIRAARAFGPFCEAIKPHVIKLPIKVGMNAIEDGPLIYAEH
                     SKYKYHFDADYTAWDSTQNREIMMESFNIMCKLTANPSLAAVVAQDLLSPSEMDVGDY
                     VISVKDGLPSGFPCTSQVNSINHWIYTLCALSEVTGLAPDVIQSQSYFSFYGDDEIVS
                     TDIEFDSNRLTQVLKEYGLKPTRPDKTDGPIIVRQQVDGLVFLRRTISKDAIGYQGRL
                     DRNSIERQLWWTRGPNHDDPFETLVPHTQRKVQLISLLGEAALHGEKFYRKIASRVIQ
                     EVKEGGLEIYIPGWQAMFRWMRFHDLSLWTGDRDLLPDYVNDDGV"
     mat_peptide     89..1219
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1220..2308
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2309..2908
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2909..3328
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3329..3871
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3872..5401
                     /gene="ORF1"
                     /product="RdRp"
     gene            5388..7022
                     /gene="ORF2"
     CDS             5388..7022
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AZJ17748.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEANTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMNNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVKVLLAGNAFTAGKIIISCIPPGFVSQNISIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDNTPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFL
                     FLVPPNVEQKTKPFSVPDLPLNVLSNSRVPSLIKFMMVSQDHGQMVQFQNGRVTLDGQ
                     LQGTTPTSASQLCKMRGTVYHASGGQGLNLTEIDGTPYHAFESPAPIGFPDIGDSDWH
                     INASPATAFGSGESVKRLDMEQGSSFAPHLGTVHYTNASYEANADLICSLEWLSPPSG
                     GTPNKVNPWAIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIANGQDGLRVPCT
                     IPQEFVTHFVNEQAPTRGEAALLHYVDPDTHRNLGEFKLYPEGFMTCVPNSSGSGPQT
                     LPINGVFTFVSWVSRFYQLKPVGTTGPVRRLGIRRS"
     gene            7022..7669
                     /gene="ORF3"
     CDS             7022..7669
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AZJ17749.1"
                     /translation="MAQAIFGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQSN
                     TFKHDKEMLGLQVGASTALLQNSLNTRYNMLTNAGLSSSDAARVVVGAPATRVVDWNG
                     TRVSAPQSTATTLRSGGFMTIPTLYKGKQQQKAPTEIGLSNPNYGSSVSSRVADWVSS
                     QNSSRSSLGPYHPSALQTTWVTPPGSSSTSTISSVSTAPRYFNTDRLPLFANMRK"
ORIGIN      
        1 gatgatggcg tctaacgacg ctattgccgt tgctgatgtc agcaataaca atgctaacac
       61 caacaatgaa aatataggat ctcgccttat ggcaaagatc cgtgggcgta taggcccaca
      121 acgtggtgaa acaaccacaa agatcaaaga tgccaacatg gcgctcgacc ttttacgccg
      181 gtcacaaaca ccatctccat gtcggcaaac taatgacagc gcccccaagg ctcaaaggga
      241 ccgtcccccg cggaccgctt cagaggtaag aagggcgctg gggtgggatg ctgaaccaga
      301 acaccaagaa agcacggcta gggcatggtg tgacctctca aaagaggaga aggaagagat
      361 aatacgtaac aatgagaggc tttttgatgc tggaggtgtc actccatcga ccctgcccag
      421 cacatttgag aggactgatt caaacagtgt cactgacgag caacaacctg tgacatggtc
      481 ttctaatgga ggggttgacc ttggcatcaa tgaattgacc acagttcgtg gcccgttttg
      541 gaatatgtgc cccctcccac cactagaagc ccgcaatagt ggccctgcta aggaacccct
      601 tataggtgac atggtcgagt tctatgaagg acacatattc cattatgcca tttacattgg
      661 acagggcaaa actattggag tccactcacc acaggctgct ttttccatac ccagaataac
      721 catccaccca ctggtggcct ggtggcgtgt gtgttacatc cccactagcc aacaacgcct
      781 tacctacgaa cagcttaagg agttggagaa tgaaccatgg ccttatgcct caatcaccaa
      841 caactgttat gagttttgct gtaaagtgat ggcacttgat gatacctggc tccaaagaag
      901 actggttact agtggaaaat ttaaccaccc cacacaggac tggtcacagg acaccccaga
      961 tttccatcag gattcgaagc ttgaaatggt aagggacgct gtcttgtcgg ccatcaacgg
     1021 tcttgtatca caacccttca agaacatcct gtctaaaatt aaaccattga atgtgcttaa
     1081 tcttttatca aactgtgact ggaccttcat gggcgtcgtg gaactggtag tgctcctggc
     1141 agaactgttt gatgtgttct ggaccccacc agacatttca agcttcattg catctttact
     1201 acctgatttt catctacagg gcccagaaga cctagccagg gacttagtcc ccctcatatt
     1261 aggtggcata ggcttagcaa ttggttttac aagagacaaa ataacaaaag tgatgaagag
     1321 cgccgttgat ggactgcggt cagcaacgca gctcggacaa tatggactgg agatattctc
     1381 aattatcaag aaatacttct ttggagggga ccaaacagaa aagaccctgc ggggcattga
     1441 agatgcggtg atagacatgg aagtgttgtc cagtaccaat gtgacgcaac tggtcaaaga
     1501 taagaagtta gccaaagctt acatgaatgt actggacaat gaggaggaga aagcaaggaa
     1561 gctctcagtc cgtagtgctg acccacatat agtgacctct gtcaacaact tgatatcacg
     1621 catctctatg gcaagatcag ctctggctaa agcccaagct gagttgacgt cccgcccacg
     1681 accagtggtt ataatgatgt gtggtcctcc tggcatcgga aagactaagg ccgctgagca
     1741 cctagccggc cgactagctg ctgaaatcag acctggaggt aaagttggcc ttgtaccccg
     1801 ggagtccata gaccattggg atggatatca tggcgaggac gtcttgctct gggatgacta
     1861 tggcatgtca aagataacag aggattgtaa taagttacag gctatagctg atactgcacc
     1921 actgtcactt aattgtgaca gaatagaaaa caaaggcatg caattctctt ctgatgcaat
     1981 aattataacc accaatgccc ctggcccagc cccagttgac tttgtcaact taggccccgt
     2041 gtgcagacga gtggactttt tagtttactg ttctgcaccc gagattgaac aaatgcggag
     2101 ggctcatcca ggtgacacca atgccatcaa ggatctgttt aaaaaggact tctcacactt
     2161 gaaaatggaa ctggctccac agggcggctt tgataatcag ggcaacacac cttttgggaa
     2221 gggtgtcatg aaaaccacaa ctctcaatag gctactgata caggccacag cattagccat
     2281 ggagcgacaa gatgaattcc aactccaggg ggctgtctac aactttgacg aggatagagt
     2341 ggccgccttc accaatctag ctcgagctaa tggcctgggg cttataagta tggcaacatt
     2401 aggcaagaag ctgagaagtg ttaagtccat ggaaggcttg cgcaatgcac tactgggata
     2461 caagattgga gagtgtgata taatctggaa caccagggtg tattcagtta agagtgacgg
     2521 gagcaatgtc acaatcaaag aaaagcaggc accgtcctca ccccaacatc aagctatttc
     2581 cacagccacc ctggcgctct ctagactgcg ggctgccaga gcccttgcgt acgcttcctg
     2641 tttacaaagt gcagtgttgt caatacttca ggttgccggc tctgccttag tggtgagcag
     2701 ggctgtaaaa cgcatgtttg gcacacgcac cgaacagccc attttggagg gtaagcataa
     2761 agaacacaac tgcagggtac accgtgcaga ggccgccggt catggcccca ttggtcatga
     2821 tggaatcatt gaacgttatg gtctgtgtga gagtgagcag gaaggagaag atgaccaaac
     2881 tgtggagttg cccactgctg acaaagaagg caagaacaaa ggcaaaacca aaaagggccg
     2941 cggacggaaa tccaacttca atgcattctc taggcgtgga cttagtgatg aggaatacga
     3001 ggagtacaag aaagtaagag aagagaaggg tggcaactac agcatacaag agtaccttga
     3061 ggaccgccag cgctatgaag aagaactcgc tgaggtgcaa gctggtggag atggtggaat
     3121 cggcgaaact gaagctgaga tccgccaccg tgttttctat aaatcaaagt ctggcttgag
     3181 aaaacagcgg caagaggaac gccgccagtt aggtctcgtg agcggtactg aaatccgcaa
     3241 acgcaaaccc atagactgga ccccccccaa aaatgattgg tcagaggaca ctagaactgt
     3301 taattatgat gaacacatca gctttgaagc ccccccttca atctggagta gagtagttaa
     3361 atttggcagt ggctggggtt tttgggtgag ttcaacagtg ttcatcacca caacacatgt
     3421 tataccacct ggtgctaaag agatctttgg tgagaacatt agcaatattg ccatccatag
     3481 agttggcgaa ttcacccaat tccgtttctc caagaaaatg aggccagacc tttctggcat
     3541 ggtcctggaa gagggatgcc ctgagggcac agtgtgcacc ataatgataa aaagagactc
     3601 tggagagctg ttgccgctgg ctgttcgtat gggagcagtg gcctcaatga agatccaagg
     3661 gaagcttatg catggacagt cagggatgtt gctcaccggt gctaacgcca agggcatgga
     3721 ccttggtacc atacctgggg attgtggagc gccctatatc cacaagagag ggaatgactg
     3781 ggtggtttgt ggggtgcatg cagcagccac gaaatcaggc aataccgtgg tgtgcgccat
     3841 acaaggtggt gaaggtgaag ccacgctaga gggtggcgat caaaataagg gtcattatgc
     3901 aggacaccca atactaagat atggtagtgg cccttcattg tcaactaaaa caaagttttg
     3961 gaaatcaaac ccccaacctc taccccctgg tacatatgaa ccagcctacc tcggtggcag
     4021 agaccccagg gttgaaggtg gtccatcttt gcagcaagta ttgcgagacc agctaaaacc
     4081 atttgctgaa ccccgtggca ggttgcctga agcaggattg ctagaagccg cggttgaaac
     4141 tgtcaccaat gcaattgaac aggtcatgga cacacctgtg gcatggagtt acggcgacgc
     4201 ctgcatgtcc ttggacaaaa caaccagttc tggctaccct catcacaaaa gaaagaatga
     4261 tgactggaac gggagttcat ttgtgagaga attgggagac caggcagcgc atgctaatag
     4321 catgtatgag cttggtaaat ctatgaaacc agtgtacaca gcagcactca aggatgagct
     4381 tgttaagcca gacaaggtgt acaataaaat taagaaaagg ctactctggg gggcggacct
     4441 cggcaccgtc atacgtgctg ctagggcttt tgggccattt tgtgaagcaa taaagcccca
     4501 tgtgattaag ttacccatta aagtgggcat gaatgccata gaagatggac ccttgattta
     4561 tgcagaacac tccaaatata agtatcattt tgatgctgat tacacagcat gggactcaac
     4621 acaaaatagg gagattatga tggagtcctt taacatcatg tgtaaactca ccgctaatcc
     4681 ctccctggcc gcagtggtgg cacaggacct gctctctcct tctgaaatgg atgtcggtga
     4741 ttatgtgatc agtgtcaaag atggcctacc atctggcttt ccatgcacct cacaagtgaa
     4801 cagtatcaac cattggatct acactttgtg cgccttatca gaggttactg gtttggctcc
     4861 tgacgtaata cagtcacagt cttacttttc attttatggt gatgatgaaa tagtttcaac
     4921 agatattgaa tttgactcaa acagattaac acaggtgcta aaagagtatg gtttaaaacc
     4981 cacaagacct gataaaactg atggtccgat cattgtaagg caacaggttg atggcttggt
     5041 tttccttcgg cgcaccatct cgaaggatgc catcgggtac cagggtcggc ttgatcgcaa
     5101 ttccattgaa agacagctct ggtggacccg agggcccaat catgatgatc catttgaaac
     5161 cttggtccca cacacacaga ggaaggtcca attaatatcc ctattgggtg aggccgcact
     5221 ccatggtgag aaattctata gaaagatagc cagtagggtg atccaggagg ttaaagaagg
     5281 aggattggaa atttacatcc ctgggtggca ggccatgttc cgctggatgc gattccatga
     5341 tttgagtttg tggacaggag accgcgatct cctgcccgat tatgtaaatg atgatggcgt
     5401 ctaaggacgc cccaacaaac atggatggca ccagtggtgc cggccagctg gtaccagagg
     5461 caaatacagc tgagcctata tcaatggagc cagtggctgg ggcagcgaca gctgccgcaa
     5521 ccgctggcca agttaatatg attgacccct ggattatgaa taattatgtg caagccccac
     5581 aaggtgaatt caccatatca ccaaacaaca caccaggtga tattctattt gatttacaat
     5641 taggccctca cctcaacccc tttttatccc atttggctca aatgtacaat ggatgggtag
     5701 gtaacatgaa agtgaaagtt ctattggcag gtaatgcttt cacggcagga aaaattatta
     5761 ttagttgtat accccctggt tttgtttcac agaatatatc tatagctcaa gctacaatgt
     5821 tcccccacgt tatagctgat gtcagggtcc tggagcccat tgaggtccca ttggaggatg
     5881 tgaggaatgt gttgttccac aataatgata acacaccaac catgagactg gtatgcatgc
     5941 tctacacccc cttgcgtgcc agcggaagct catctgggac agaccccttt gtgattgctg
     6001 ggcgtgtgtt gacttgccct agtcctgatt ttagcttcct attcttggtg ccccccaatg
     6061 tagaacaaaa gactaaacct tttagtgtcc cagatctccc actcaatgtt ctatcaaatt
     6121 caagggtgcc gtcactgata aaatttatga tggtgtcaca ggaccacgga cagatggtac
     6181 aatttcagaa tggcagggtc acactggatg gacagctcca gggcaccaca ccaacatcgg
     6241 ccagccagct ctgcaagatg cgggggacgg tttaccatgc ctccggtggt caagggctca
     6301 atttaactga gattgatggc accccctatc atgcatttga aagtccagct cccattggtt
     6361 tccctgacat aggagacagc gattggcaca tcaacgcttc acccgccacc gccttcggca
     6421 gtggcgaaag cgtcaaaaga ctagatatgg aacagggctc ttcatttgcc ccacatttgg
     6481 gtactgtaca ctatactaat gccagctatg aagccaatgc tgatctgatc tgctcattgg
     6541 agtggctatc cccgcctagc ggaggcactc caaacaaagt caatccttgg gccattccac
     6601 ggtatggttc aactttgact gaagctgctc agctagcccc accaatttac ccccctggct
     6661 ttggagaagc tatagttttc tttatgtctg actttcctat agcaaatggt caagatgggt
     6721 taagagtgcc ctgtactata ccccaagaat ttgtaaccca ttttgtcaat gaacaagcac
     6781 caacccgtgg ggaagctgcc cttcttcatt atgttgatcc cgacacacac cgcaatttgg
     6841 gtgagtttaa gctataccct gaaggattta tgacttgtgt accaaattcc agtggtagtg
     6901 gtccccaaac gctgcctatc aatggagtct tcacttttgt ctcttgggtt tctcgtttct
     6961 atcaactaaa gcctgtggga acgaccggac cggttcgtag gctaggaatc aggagatcat
     7021 aatggcccag gcaatatttg gagcaatagc tgcgacggct gctggcagcg ctgtgggtgc
     7081 aggcattcag gctggtactg aggccgcact ccaacatcag cggttccagc aggatttaac
     7141 gttgcagagc aacactttca aacatgacaa agaaatgcta gggctacagg ttggtgcttc
     7201 cactgctctc ttgcaaaaca gcctcaacac ccgctacaac atgctcacaa atgctggtct
     7261 ctcgtcctca gatgcagcac gcgtggtggt tggcgcgcca gccacacgtg ttgttgactg
     7321 gaacggtact agggtgtcag caccacaatc tacagctacc acgttgaggt ctggtgggtt
     7381 catgacaatc ccaactctgt acaagggcaa acaacagcaa aaagctccaa ctgaaattgg
     7441 cttgtctaac ccaaattatg gttcatctgt gtcttctagg gttgctgatt gggtttcctc
     7501 tcaaaattct tctcgctcat ccttgggccc gtatcacccc agtgctttgc agacaacatg
     7561 ggtgacccca cccggttcta gttctacttc tactatttct tctgtgtcta ctgcacctag
     7621 atatttcaat actgataggt tgcctctatt cgcaaatatg aggaaataat ttttgtaata
     7681 tgaaatatgg g
//