Typing tool

Complete norovirus genomes

MK073886  GII.3
 GII.P12

Length: 7,532 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6730
ORF3: 6730..7494
LOCUS       MK073886                7532 bp    RNA     linear   VRL 07-FEB-2019
DEFINITION  Norovirus GII.3 isolate Hu/USA/2016/GII.P12-GII.3/AnnArbor-0027
            nonstructural polyprotein (ORF1), VP1 (ORF2), and VP2 (ORF3) genes,
            complete cds.
ACCESSION   MK073886
VERSION     MK073886.1
DBLINK      BioProject: PRJNA322324
KEYWORDS    .
SOURCE      Norovirus GII.3
  ORGANISM  Norovirus GII.3
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7532)
  AUTHORS   Soehnlen,M., Riner,D., Mosher,L., Vavricka,V., Castro,C.J.,
            Marine,R. and Rodeman,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2018) Polio and Picornavirus Laboratory Branch,
            Centers for Disease Control and Prevention, 1600 Clifton Rd. NE,
            Atlanta, GA 30329, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 3.9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7532
                     /organism="Norovirus GII.3"
                     /mol_type="genomic RNA"
                     /isolate="Hu/USA/2016/GII.P12-GII.3/AnnArbor-0027"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:490041"
                     /country="USA: MI, Washtenaw County, Ann Arbor"
                     /collection_date="16-Feb-2016"
                     /note="genotype: GII.P12-GII.3"
     gene            4..5103
                     /gene="ORF1"
     CDS             4..5103
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZJ17744.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSSMAVTFKRALGARQ
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKVGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVIMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     SELKQALKNVAIKSCQIVYGGCTYRLESDGKGDVRVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEEIASKDGC
                     PKPQDGEEFVISSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGRPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     4..993
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     994..2091
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2092..2628
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2629..3027
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3028..3570
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3571..5100
                     /gene="ORF1"
                     /product="RdRp"
     gene            5084..6730
                     /gene="ORF2"
     CDS             5084..6730
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AZJ17746.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNAPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPEFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDNEADFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTVA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRVQ"
     gene            6730..7494
                     /gene="ORF3"
     CDS             6730..7494
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AZJ17745.1"
                     /translation="MAGAFIAGLAGDIFTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPSATSTTSMSGGFTNQAVHRTTPNFKMNQAPRSTPSSGSSVRSLSTQVTSLSS
                     HSSGSSRSSGSSSLPSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSLG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttcc gctgccgctg ctgctaatag caacaacgac
       61 aacgcaaaat cttcaagtga cggagtgctt tctagcatgg ctgtcacttt taaacgagcc
      121 ctcggggcgc ggcaaaaaca gcctcccccg agggaaacac cacaaaggcc tccacggcca
      181 cccactccag aactggtcaa aaagatccct cctcccccac ccaatgggga ggatgagcta
      241 gtggtctctt atagcgccaa agatggcgtt tctggtttgc ctgaactcac cactgtctgg
      301 caaccggatg agaccaacac ggcattcagt gttccccctc tcaaccaaag ggagaacagg
      361 gacgccaagg agccgctgac cggaacaatc ctggaaatgt gggacgggga gatctatcat
      421 tacggtctgt atgtggagcg aggccttgta cttggtgtgc acaaaccacc agctgccatc
      481 agcctcgcca aggttgaact agcaccactc tctctatttt ggaggccagt gtacacacca
      541 cagtatctca tctctccaga cactcttagg agactgcatg gagagtcgtt cccctacaca
      601 gcctttgaca acaactgcta tgccttctgt tgttgggttc tggacctaaa cgactcgtgg
      661 ttgtgcagga gaatgatcca gagaacaact ggcttcttca gaccttacca agaatggaac
      721 aggaaacccc tccctaccat ggatgactct aaattgaaaa aggtagccaa catattcttg
      781 tgtgcgctat cttcgctatt cactaggccc atcaaagaca taataggaaa ggtaagaccg
      841 ctcaacatcc ttaacatcct ggcctcatgt gattggactt ttgcaggcat agtggaatct
      901 ttgatcctct tggcagagct ctttggagtt ttctggacac ccccagatgt gtctgcgatg
      961 atcgccccct tactaggtga ctacgaactg caggggcctg aggaccttgc agtggaactc
     1021 gtaccagtag tgatgggagg gattggtttg gtgttaggat tcaccaaaga gaaggtcgga
     1081 aaaatgttgt catccgccgc ttccacctta agagcttgta aagaccttgg tgcatacgga
     1141 ctggaaatcc taaaattggt catgaaatgg ttcttcccaa agaaagagga agcaaatgag
     1201 ctagctatgg tgaggtccat cgaggatgcg gtgctggacc tcgaagcaat tgagaacaac
     1261 cacatgactg ccctcctcaa agacaaagac agcttggcaa cctacatgag gacccttgac
     1321 ctcgaggagg agaaagccag gaagctttca accaagtctg cttcacctga catcgtgggc
     1381 acaatcaacg ctcttctggc gagaatcgcc gctgcacgtt ccctggtgca tcgggcgaaa
     1441 gaggagctct ccagcagacc aagacctgtt gttattatga tatcaggtag gccagggata
     1501 gggaaaactc accttgccag ggagctagcc aagaagatcg cagcttcact cacaggggac
     1561 cagcgcgtgg gtctcatccc ccgcaatggc gttgaccact gggatgcata caagggagaa
     1621 agagtcgtcc tatgggacga ttatggaatg agcaatccca tccacgacgc cctcaggcta
     1681 caggaacttg ctgacacctg cccccttacg ctaaactgtg acaggattga gaacaaagga
     1741 aaggtctttg acagtgatgc cataatcatc accactaatc tagccaaccc agcaccattg
     1801 gactatgtca actttgaagc atgctcgagg cgcattgact tcctcgtgta cgcagaagcc
     1861 cctgaggtcg agaaagcaaa gcgtgatttc ccaggtcaac ctgacatgtg gaagaacgca
     1921 tttagctctg acttctcgca cataaaactg gcgctggctc cgcaaggtgg tttcgacaag
     1981 aacggaaaca ccccacacgg gaaaggcgtc atgaaaaccc tcaccactgg ttccctcatc
     2041 gcccgagcat cagggctact ccatgagagg ttggatgagt acgagctgca gggcccaact
     2101 cccaccacct ttaattttga ccgcaacaag gtgcttgcgt tcagacaact tgctgccgaa
     2161 aacaagtatg gattgttgga cacaatgaga gttggaaaac agctcaagga tgttaagacc
     2221 atgtcagagc tcaaacaggc actcaagaat gtcgcaatca agagttgtca gatagtgtat
     2281 ggtggctgca cctacaggct tgagtctgat ggcaagggtg atgtaagagt tgacagagtt
     2341 cagaacgcca ctgtacagac caacaatgag cttgccggcg cactacacca tcttaggtgc
     2401 gccagaatca gatattatgt caagtgtgtt caggaggccc tgtattccat catccaaatc
     2461 gctggggctg catttgttac cacgcgcatt gtcaagcgca tgaacataca agatctctgg
     2521 tccaagccac aggtggagga tacagaggaa atcgctagca aggatgggtg cccaaaaccc
     2581 caggatggtg aagagtttgt tatctcatcc gacgacatca aaaccgaggg caagaaaggg
     2641 aagaacaagt ctggccgtgg caagaaacac acagcatttt caagtaaagg tctcagtgat
     2701 gaagagtacg atgagtacaa aagaatcaga gaagaaagaa atggcaaata ctccatagag
     2761 gaatacctcc aggacagaga caggtattat gaggaggtgg ccatcgccag ggcaaccgaa
     2821 gaggacttct gtgaagaaga agaggccaag atccgacaga ggatcttcag gccaacaagg
     2881 aaacaacgca aagaggagag agcctctctc ggtttggtca caggttctga aatcaggaag
     2941 aggaacccag acgacttcaa gcctaaagga aagctgtggg ctgatgatga caggagtgtt
     3001 gactacaatg agagactcaa ttttgaagcc ccaccaagca tctggtcgag gatagtcaac
     3061 tttggctcag gttggggttt ttgggtttcc cccagcctgt tcataacatc aactcatgtt
     3121 ataccccagg gcgcacagga gttctttggt gtgcccatca aacaaatcca gatacacaaa
     3181 tcaggtgaat tctgccgctt gaggtttcca aagccgatca gaactgacgt gacaggcatg
     3241 atcttagaag aaggtgcacc cgaagggacc gtggtcacat tactcatcaa aagaccaact
     3301 ggagagctca tgcccctggc agccagaatg ggaacccacg caaccatgaa gatacaaggg
     3361 cgcactgtcg gaggtcaaat gggcatgctc ctaacagggt ccaacgccaa gagtatggac
     3421 ctgggcacca caccaggtga ctgtggctgc ccctacattt acaagagggg gaatgactac
     3481 gtggtcattg gggtccatac agctgccgcc cgtggaggaa acactgtcat ttgtgccacc
     3541 caggggagcg agggagaagc cacacttgaa ggcggtgata gcaaggggac ctactgcggt
     3601 gcaccaatct taggtccagg aagtgcccca aaactcagca ccaagaccaa gttctggagg
     3661 tcatccacgg caccactccc acctggtacc tatgaaccag cttacctcgg tggcaaggac
     3721 cccagagtta agggtggccc ttcactgcaa caagttatga gggatcaact gaaaccattc
     3781 actgagccta ggggtaggcc accaaaacca agtgtgctag aagctgccaa gaaaaccatc
     3841 gtcaatgtcc tagaacagac aattgaccca cctcaaaagt ggtcgtttgc gcaggcatgc
     3901 gcatcccttg acaagaccac ttctagcggt catccgcacc acatgcggaa gaatgactgt
     3961 tggaacgggg agtccttcac aggaaaattg gcagaccagg cttccaaggc caacctgatg
     4021 tttgaggagg gaaagaacat gaccccagtt tacacgggtg cgcttaagga tgagctggtc
     4081 aagactgaca agatttatgg taagatcaaa aagaggcttc tctggggttc tgacctggcg
     4141 accatgattc ggtgcgctcg agcattcggg ggactgatgg aggaactcaa agcacattgt
     4201 gtcacactac ctgttagggt gggtatgaat atgaatgagg atggccctat catctttgag
     4261 agacactcca gatataaata tcattatgat gctgattact cccggtggga ttcaacacaa
     4321 caaagagctg tgttggcggc agccttagaa atcatggtca agttttcccc agagccgcac
     4381 ctggcccaaa aggttgcaga agaccttctt tctcccagcg tgatggacgt gggtgatttc
     4441 aaaatatcaa tcaatgaggg tctcccctcc ggagtgccct gcacctccca atggaactcc
     4501 atcgcccact ggctcctcac tctctgtgca ctctccgagg ttacaaacct gtcccctgac
     4561 attgttcagg ctaactctct cttttctttc tacggtgatg atgaaattgt gagtacagac
     4621 ataaaattgg acccagaaaa actgacagca aaactcaagg aatacgggtt gaaaccgacc
     4681 cgccctgaca aaactgaagg gcctctcgtc atttccgaag acctgaatgg cctaaccttc
     4741 ctgcggagga ccgtgactcg cgacccagca ggttggtttg ggaagttgga acagagctca
     4801 atactcaggc aaatgtactg gactaggggc cccaaccatg aagatccatc tgaaacaatg
     4861 ataccacact cccagaggcc catacaattg atgtccttgc tgggagaggc agcactccac
     4921 ggcccagcat tctacagcaa aatcagtaaa ctggtcattg cagagttgaa ggagggtggc
     4981 atggattttt acgtgccaag acaagagcca atgttcagat ggatgagatt ctcggatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgaa
     5101 tgacgccact ccatctaatg atggtgccgc cggcctcgtc ccagagatca acaatgaggc
     5161 aatggcgcta gaaccagtgg cgggtgcagc gatagcagca cccctcaccg gccagcaaaa
     5221 tataattgat ccctggatta tgaataattt tgtgcaagca cctggtggtg agttcacagt
     5281 gtctcctagg aatgcccctg gtgaagtgct cctcaatttg gaattgggcc cagagataaa
     5341 cccctatctg gcccatcttg ctagaatgta taatggttat gcaggtgggt ttgaagtgca
     5401 ggtggtcctg gctggaaatg cgtttacagc aggaaagata atctttgcag ctataccccc
     5461 taacttccca attgacaatc taagtgcagc acagatcaca atgtgtccac acgtgattgt
     5521 ggatgtcagg cagttggaac cggtcaacct cccgatgcct gacgttcgta acaacttctt
     5581 ccactacaac caagggtctg attcgagatt gcgcttggtt gcaatgctgt atacacctct
     5641 tagggcaaat aactctgggg atgatgtttt cactgtgtct tgtagagtgc tgactagacc
     5701 tagtcctgaa ttttcattta acttccttgt gccccccact gtggaatcaa agacaaaacc
     5761 ctttaccctc ccaattctga ctatctctga aatgtctaat tctaggtttc cagtgccgat
     5821 tgactctctg cacaccagcc caactgagaa tattgttgtc cagtgtcaaa atggacgcgt
     5881 cactcttgat ggtgagttga tgggcaccac tcagctctta cctagtcaaa tctgtgcttt
     5941 caggggcgtg ctcactagat caacaagcag ggctagtgac caggccgaca cagcaacccc
     6001 tagattgttt aattattatt ggcacataca attggataat ctaaatggga ctccttatga
     6061 tcctgcagaa gacataccag gccccctagg gacaccagat ttccgaggca aagtctttgg
     6121 cgtggccagc caaagaaacc ccgacagtac aactagagca catgaagcaa aggtggacac
     6181 aacagctggt cgcttcaccc caaaactagg ctcattagag atatccactg aatctggtga
     6241 ctttgaccaa aaccaaccaa caagattcac cccagttggc attggggttg acaacgaggc
     6301 agacttccaa caatggtcct taccagacta ctctggccag ttcactcaca acatgaactt
     6361 agccccagct gttgctccca acttccctgg tgagcagctc cttttcttcc gctcacagtt
     6421 accatcttct ggtgggcgat ccaatgggat tctagactgc ctggtccccc aagaatgggt
     6481 ccagcacttc taccaagaat cagcccccgc ccaaacccag gtggctctgg ttagatatgt
     6541 caaccctgac actggtagag tgttgtttga ggccaagctg cacaaattag gtttcatgac
     6601 tgtagctaag aatggtgact ctccaataac tgtcccccca aatggatact ttaggtttga
     6661 atcttgggtg aacccatttt atacacttgc ccccatggga actgggaacg ggcgtagaag
     6721 agttcaataa tggctggtgc ttttatagca ggattagctg gtgatatatt cacaaacact
     6781 gtagggtctc tagttaatgc aggggctaat gctatcaatc aaaaagttga ttttgaaaat
     6841 aacaaatact tgcaaaatgc ttccttcaat catgataagg aaatgttaaa tgcacagatt
     6901 gaggcaacaa agaggttaca ggctgacatg attgctatca aacagggggt tttgaccgct
     6961 ggcggctttt cccccactga tgcagctcgc ggggcaatta acgcccccat gacaaaagtc
     7021 ctagattgga atggaacaag gtactgggca ccaagtgcca cctctacaac ctcgatgtcg
     7081 ggtggcttca caaaccaggc tgtgcacaga accacgccaa attttaaaat gaaccaggcc
     7141 cccagatcca cacccagcag tgggtcttca gtgaggtcac tctcaaccca agtcactagt
     7201 ctgagctcac actcgtccgg gtcgtctcga tctagcgggt ctagctcatt accatcctta
     7261 ccatcctcta acaggactag ggactgggtc aatcagcaaa atttcaattt ggaaccacac
     7321 atgcctgggt cgcttaggac ggcttttgtc actccaccat ctagtacagc ctctagttta
     7381 ggcactgtct caaccgtgcc caaaaatgtt ttggactcct ggacatctgc gtttaacacg
     7441 cgcagacagc cgctattcgc acaccttcgt agaagggggg agtcaaatgt ttagtgaaaa
     7501 ggttatttta aatttgattt aaatttgatt tg
//