Typing tool

Complete norovirus genomes

MH671553  GII.2
 GII.P2

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       MH671553                7536 bp    RNA     linear   VRL 20-AUG-2019
DEFINITION  Norovirus GII isolate BJFTJYX, complete genome.
ACCESSION   MH671553
VERSION     MH671553.1
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Ao,Y.
  TITLE     Genetic analysis of an emerging GII.P2-GII.2 norovirus associated
            with an acute gastroenteritis outbreak in 2016, in China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Ao,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2018) Viral Diarrhea, Institute for Viral Disease
            Control and Prevention of China CDC, No 100 Ying Xin Street Xuan Wu
            District, Beijing, Beijing 100052, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="BJFTJYX"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:122929"
                     /country="China: Beijing"
                     /collection_date="2016-12"
                     /collected_by="Yuanyun Ao"
                     /note="genotype: GII.P2-GII.2"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AXQ39877.1"
                     /translation="MKMASNDASAAAAVNSNNDNIKSSSDGMLNNMAVTLKRALGARP
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTAGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILMAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPISTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIRKCQIVYGGNTYTLESDGKGKVVVERVQSASVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIVSRMNIQNLWSRPLSEDADEATIKEGC
                     PKPRDEEEFIVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQVVEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGYPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGRIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKVSINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RdRp"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AXQ39878.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     IISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDIEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; small basic protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AXQ39879.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPSSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFVTQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSAVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgtcaaca gcaacaacga
       61 caacataaaa tcttcaagtg acggaatgct taataacatg gccgtcaccc ttaaacgagc
      121 ccttggggcc cggcccaaac agccagcccc gagggaaaaa cccccaagac cccctagacc
      181 accaacacca gaactaatca aaaggatccc tcccccacca cctaatgatg gggacgaacc
      241 aaccgtgatg tttagcactg caggtggtgt ttctggccta cctgagctca caacagtcgg
      301 tcaaccacct gaagctaaca ctgcctttag tgtgcccccc cttagccaaa gggaaaacag
      361 ggacgctaag gaaccgttaa ctggggctat tctggaaatg tgggatgggg agatttatca
      421 ttatggactg tatgtggaaa aagggcttgt gctaggcgtg cacaagccgc cggctgccat
      481 cagcatagcc aaagtggaat tgacacccct ctcactgtat tggaggcccg tgtacacgcc
      541 tcagtacctc atatctcctg acaccttgag gaaacttcac ggtgagttat tcccctatac
      601 agcctttgaa aacaactgtt atgccttctg ctgttgggtt ttggacctca acgattcatg
      661 gctaagcaga aggatgatta gtaggactac tggcttcttc aggccctacc aagagtggaa
      721 caggaagcct ctccctacta tggatgactc aaaattgaag aaggtcgcaa acatcgttct
      781 ttgcgcattg tcatcattgt tcactaggcc cattaaggat ataattggca aacttaaacc
      841 ccttaacatc ctaaacattc tggcctcatg cgattggacc ttcgctggta tagtagaatc
      901 actaatcctc atggctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcaccc ctcctcggcg actatgagct acaaggtccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gtgatgggtg ggataggtct ggtgttggga ttcaccaaag agaaaatagg
     1081 caagatgctc tcctctgcag cgtcaactct gagggcgtgc aaagatcttg gagcctatgg
     1141 attggagata ctgaaactag tcatgaaatg gtttttccca aagaaggatg aggccaacga
     1201 actggctatg gttagagcca ttgaagacgc cgtattagat ctggaggcta ttgagaacaa
     1261 ccatatgacc actctattga aagacaagaa cagccttgca gcatacatga agaccctgga
     1321 tatggaagag gaaaaagcta ggaagctgtc caccaaatca gcctcccctg acattgtggg
     1381 cactataaac gccctgctgg ctaggatcgc tgccgcgcgt tccctagttc acagggccaa
     1441 ggaggagctc tccagcaggc caagaccagt cgttttgatg atctctggca agccagggat
     1501 aggaaagacc cacttggcca gagaactggc aaagaaaatt gcctcgacac tcacaggaga
     1561 ccaaagggtt ggtcttatcc cacggaatgg agttgaccat tgggatgcct acaaaggtga
     1621 gagagtggtg ctctgggatg actatgggat gagcaacccc atccacgatg cgctgaggct
     1681 gcaggaattg gcagacacat gtccattaac tctaaattgt gacaggattg aaaacaaggg
     1741 gaaggtcttc gacagcgacg cgatcataat caccaccaat ttggtcaacc ccgcgccgct
     1801 ggattatgtc aactttgagg cctgctccag acgtatagac ttccttgtat atgctgatgc
     1861 cccagaagtc gagaaagcaa agcgggactt tcccggtcaa ccggacatgt ggaaggacgc
     1921 ctatcgctct gacttctcac acattaaact acaacttgcg ccacaaggtg ggtttgacaa
     1981 aaatggcaac accccacatg gtaaaggagt gatgaagact ctcactgcca gctcactggt
     2041 cgcacgtgcc tctggtctct tgcacgagag attagatgag tacgagctgc aaggtccgcc
     2101 catctcaacc ttcaactttg accgtaacaa aattgcagcg ttcagacaac tcgctgctga
     2161 aaacaagtac ggtctggtag acacgatgag ggtgggcaac cagctcagaa atgtcacgac
     2221 catggatgaa ctcaagaagg ctatcaagaa catcataatc agaaagtgcc agatagtcta
     2281 tggtggcaac acttacacgc ttgagtctga cggcaagggc aaggttgtag ttgagagggt
     2341 gcagagcgcc agcgtgcaaa ttaacaatga gatcgctggt gcagtacacc atcttagatg
     2401 tgccagaata aggtattatg tcaagtgtgt ccaagaggct atatactcac tcctccagat
     2461 tgccggcacg gtgtttgtca cttcacgcat cgtaagccgc atgaacatcc aaaatctgtg
     2521 gtctaggcca ctatctgaag atgcagatga ggccaccata aaagaggggt gccccaaacc
     2581 tagggatgaa gaagaattta tcgtatcctc agatgatatc aagccagagg gtaagaaagg
     2641 taaaaacaag agtggccggg gcaagaaaca cacggcattc tcaagcaaag ggctcagtga
     2701 tgaggagtac gaagagtaca aaagaatcag agaggagaga aatggcaagt actccataga
     2761 ggaataccta caggacagag acaagtacta tgaagaggtg gccattgcca gggcaactga
     2821 agaagacttc tgtgaagaag aagaggttaa gattcgtcag aggatcttca ggccaacaag
     2881 aaagcaacgc aaggaagaaa gagccaacct tggccttgtt accgggtctg agatcaggaa
     2941 gagaaaccca gatgacttca aaccaaaagg aaaactgtgg gccgacgacg acaggagcgt
     3001 cgattacaat gaaagaatca gctttgaggc cccaccaagc atttggtcta gaattgtcaa
     3061 ctttggttct ggatgggggt tctgggtgtc acctagcctc ttcataacat caacacacgt
     3121 catacctcaa ggcataactg aggcctttgg tgtacccata aggcaggtgc aaatacacaa
     3181 atcgggcgag ttctgtcgcc tgagattccc aaaacccatc agaacagatg tgtcaggcat
     3241 gatactggag gagggagcgc ctgaaggcac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctctag cagcaagaat gggcacccac gcgaccatga ggatacaagg
     3361 gcgcacagtg ggcggccaga tgggaatgtt gctcactggg tccaatgcga agagcatgga
     3421 tctcggcacc acgcccggtg actgtgggtg tccctacatt tacaaaaggg gcaatgatta
     3481 catagtcatt ggagttcaca cagcagccgc tcgtggcgga aacactgtca tctgcgctac
     3541 acaagtagtg gagggtgagg ctactctcga gggtggtgac aataaaggaa catattgtgg
     3601 ggcaccaatc ttaggccctg gaaatgcccc aaaactgagc actaaaacca agttctggag
     3661 gtcctctaca acaccactcc cacccggcac gtacgagccg gcatatctgg gaggaaaaga
     3721 cccccgagtc aaaggtgggc catctctgca acaagtcatg cgagaccaac tgaagccgtt
     3781 caccgaaccc cgtggtaagc caccaaaacc aagtgtcctt gaagctgcta aaaagacaat
     3841 tatcaatgtg ttagagcaaa caatagaccc cccacagaag tggacgtacg cgcaagcgtg
     3901 cgcgtctctt gacaaaacca catctagtgg gtacccccac cacgtgcgca aaaacgagca
     3961 ctggaatggg gaatctttca cgggaaaatt ggctgaccag gcatcaaagg ctaacctaat
     4021 gtttgaagag gggaaacaca tgaccccagt ttatacagct gcccttaagg atgagttggt
     4081 caaaactgag aaagtgtatg ggaggataaa gaagaggttg ctctggggct ctgacttggc
     4141 caccatggtg aggtgtgcgc gctcctttgg cggtttgatg gacgaactca aggcccactg
     4201 tgtgacactc ccgataaggg ttggcatgaa tatgaatgaa gatggaccaa tagtctttga
     4261 gaaacattcc agatacaggt atcactatga tgcagactac tccaggtggg attcaacaca
     4321 gcagagagcc gttctggccg cagccatgga gattatggtt aaattctcag cagaaccaca
     4381 attagcccaa atagttgcag aggatctgtt gtcgcccagt gttgttgacg tgggcgactt
     4441 taaagtttcc atcaacgaag gattaccatc gggtgtccct tgcacctctc aatggaactc
     4501 catcgcacac tggctcctca ccttgtgtgc cctttctgaa gttacagacc tctctcctga
     4561 cattgtgcaa gccaactccc tcttctcctt ctatggtgat gatgaaattg tgagtacaga
     4621 catcaaatta gacccagaaa agttgacggg gaagttgaga gaatatggtc tcaaacccac
     4681 ccgtcctgac aaaactgagg gccccttgat tattagcgag gatctgaacg gcctgacctt
     4741 cctgaggaga accgttaccc gcgaccctgc aggatggttt ggcaaactgg accaaagctc
     4801 catacttagg caattgtatt ggaccaaagg ccctaatcat gaagacccct ttgagtcaat
     4861 gattccacat tcccagaggc ccatacaact catgtcactc ttgggtgaag cagcactgca
     4921 tgaaccatca ttttacagca agatcagcaa acttgtgata tctgagttga aagaaggtgg
     4981 aatggatttt tacgtgccca ggcaagaacc tatgtttagg tggatgagat tctcggattt
     5041 gagcacgtgg gagggcgatc gcaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aacaatgagg
     5161 tcatggctct tgaacccgtg gctggtgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccccaatggt gaatttacag
     5281 tttctccccg aaatgcccct ggtgaagtgc tactgaatct agagttgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaatgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gccgtgccac
     5461 ctcacttccc agttgaaaat cttagcccac agcaaattac catgttccct cacgtgatca
     5521 tagatgtgag aaccttggaa cctgttttat taccactccc tgatgttagg aataatttct
     5581 tccattataa tcagaaagat gaccccaaga tgagaattgt ggccatgctt tatacccccc
     5641 ttaggtctaa tggttcgggt gatgatgtgt ttacagtctc ctgcagagtg ttaactagac
     5701 cttcccctga ttttgacttt acatacctgg tgccaccaac agtggagtct aaaacaaaac
     5761 cattcaccct cccaatactc acacttgggg aactttccaa ttctaggttc ccagtgtcca
     5821 tagaccagat gtacaccagc cctaatgaag ttatatcagt gcagtgtcaa aatggtaggt
     5881 gcacactgga cggggagctc caagggacaa cacaactcca agtcagtggc atttgtgctt
     5941 tcaaaggtga agtgaccgcc cacttgcatg acaatgatca cctatataat gttaccatca
     6001 caaacttgaa tgggtcccct tttgatccct ccgaggatat ccccgcccct ctgggcgtgc
     6061 ctgatttcca gggaagggtc tttggtatca tctcccaaag agacaaacac aatagtcccg
     6121 ggcacaatga accagcaaac aggggacacg acgctgtggt ccctacttac acagcacagt
     6181 acactccaaa actgggacaa attcaaattg gcacatggca gactgacgac cttacagtca
     6241 accaaccagt caaattcacc ccagttggac tcaatgacat tgaacatttt aaccaatggg
     6301 tggtccctag gtatgctggt gccctaaatc tcaacacaaa ccttgcccct tctgttgctc
     6361 cagtattccc aggagagcgc ctgctcttct tcagatcata cattcccctc aagggtggtt
     6421 atggaaaccc agccattgat tgcctactac cacaagagtg ggtgcaacac ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc ttgtcaggta catcaacccg gatactggtc
     6541 gggcactgtt tgaggccaag cttcacagag ctggtttcat gacagtctcg agcaacacca
     6601 gtgccccggt ggttgtgcct gccaacggat acttcagatt tgattcttgg gtgaatcagt
     6661 tctattctct cgcccccatg ggaactggga atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggctcagtt cattaatcaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga aattgcagca
     6841 aaattctttt aatcatgaca aggagatgtt gcaggctcag attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta tcaaacaagg ggtcttgacc gctggcggct tttcccctgc
     6961 tgatgcagcc agaggtgctg tgaacgcgcc catgacacag gcgctggatt ggaatggcac
     7021 aagatattgg gcaccaagct ccatgaggac cacatcctat tctggaaagt tcacatcaac
     7081 cgccccagtg aggcaggccg acttccagca cacccaaagc cggccttcga gtggctcttc
     7141 tgtgtcttct tttgtcaccc agtcttcaag gccaactctg actacaacta ctggttcctc
     7201 acatggtaca gcctcatcaa attcaactcg cagcacaagc ctctcccaat cagcggtctc
     7261 cagagctaca tctaggactg gtgagtgggt tagagatcaa aatagaaatt tggaacccta
     7321 catgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg cgtctgacgg
     7381 gacagtctca accgtcccga aaggtgtttt ggactcctgg acacctgcgt ttaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaattta tttaggatga attgatttta cctttt
//