Typing tool

Complete norovirus genomes

MG892953  GII.3
 GII.P16

Length: 7,568 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       MG892953                7568 bp    RNA     linear   VRL 09-MAY-2019
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.3/RUS/Novosibirsk/NS17-A1029/2017, complete genome.
ACCESSION   MG892953
VERSION     MG892953.3
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7568)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Molecular epidemiology of human noroviruses associated with
            sporadic gastroenteritis in Russia
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7568)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2018) Siberian Branch of the Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine
            (ICBFM SB RAS), 8 Lavrentiev Avenue, Novosibirsk 630090, Russia
COMMENT     On Apr 23, 2019 this sequence version replaced MG892953.2.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7568
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.3/RUS/Novosibirsk/NS17-A1029/2017"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: F; age: 23 Y"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="11-Apr-2017"
                     /note="genotype: GII.P16/GII.3"
     5'UTR           1..4
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AVO62574.2"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDEPQKPPRPPTPELVKRIPPPPPNGEEEEEPVIRYEVKSGISGLPELTTVPQ
                     PNVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAA
                     ISMARVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLI
                     GKIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRL
                     STKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLAR
                     EVARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELAD
                     TCPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEV
                     EKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIA
                     RASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMKVGNQLKGVK
                     TMEELKQAIRNVTIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHH
                     LKHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPQLDQNESETKEE
                     APKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLV
                     TGSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEG
                     TVATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILG
                     PGGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFW
                     NGETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKIYGKIKKRLLWGSDL
                     STMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTKLSPDIIQANSMFSFYGDDEIVSTDIKLDPEQLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..1000
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     1001..2098
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2099..2629
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2630..3028
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3029..3571
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3572..5101
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5085..6731
                     /gene="ORF2"
     CDS             5085..6731
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AVO62575.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSKLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPEFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDQESDFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRVQ"
     gene            6731..7495
                     /gene="ORF3"
     CDS             6731..7495
                     /gene="ORF3"
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="AVO62576.2"
                     /translation="MAGAFVAGLAGDILTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPSATSTTSMSGGFTNQAVHRTTPNFKMNQAPRSTPSSGSSVRSLSTQITSLSS
                     HSSGSSRSSGSTVASSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
     3'UTR           7496..7547
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt tacaaatatg tcttccacct taaagaaagc
      121 cctcggggct aggcccaaac agcctgcccc gagagacgaa ccacaaaagc ccccaagacc
      181 accaactccc gagttggtca agaggatacc ccctcctcca cctaatggcg aagaagaaga
      241 agaaccagtc attaggtatg aggttaagag tgggatctct ggcctgcccg agctcacaac
      301 agtcccccaa ccgaacgtgg ccaacacagc attcagtgtt ccaccactga gcttgagaga
      361 aaacagggag gccaaggaac cgctaacagg ggcaatatta gagatgtggg atggagagat
      421 ataccactat ggactgtacg tggagaaagg cttagtgttg ggtgtgcaca aaccacctgc
      481 agccataagc atggcaagag tggagctgac gccgctgtca ttgtactggc gtgtggtgta
      541 cactccccaa tacctcatct cccctgaaac tctcagaagg ctcaacggag aggcgttccc
      601 ttacaccgcc ttcgacaaca actgctatgc cttttgctgc tgggtgttag acctcaatga
      661 ctcatggctt agcaggagga tggtgcagag aacaacgggc ttcttcagac cttaccaaga
      721 gtggaacaga aaacccctgc ctaccatgga tgactccaaa attaagaagg tagcaaatat
      781 attcctatgt tcattgtcca cattattcac cagacccata aaagacctca taggaaaaat
      841 taaaccatta aacatattga acatcctggc aacgtgtgac tggacgtttg ccggaatagt
      901 ggagtctctg atattacttg ctgaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgctatgatc gctcccttac tcggggacta cgagttgcaa gggccagaag acctcgccgt
     1021 cgaactcgta ccagtggtaa tgggagggat tggtttggtg ttgggattca ccaaagagaa
     1081 aattggcaaa atgttgtcct cagcagcatc aacactcagg gcttgcaaag atcttggtgc
     1141 ctatggctta gagatactca aattggtcat gaagtggttc ttcccaaaga aagaggaggc
     1201 caatgagcta gccatggtga gggccataga ggatgccgta ctagatcttg aggcaataga
     1261 aaataaccac atgacaaccc tgttgaaaga caaagacagc ttagcaacat acatgaaaac
     1321 actggacatg gaggaggaga aagccagaag gttgtccaca aaatctgcat cccctgacat
     1381 agttgggaca atcaacgccc tgctggctcg aatagcagcg gccaggtcat tagtccacag
     1441 ggccaaggaa gagctatcta gcaggatgag accagtagtt gttatgatat ctggcaaacc
     1501 agggataggc aaaactcatc tggccaggga ggtggcgaga aaggtggcat ctactctcac
     1561 aggggatcaa agagtcggac tcataccaag aaacggtgtg gaccattggg acgcatacaa
     1621 aggtgagaga gtcgtgctgt gggacgacta tggcatgagt aaccccattc atgatgctct
     1681 ccgcatacaa gaattggctg atacgtgtcc ccttacctta aattgtgaca gaattgaaaa
     1741 taagggaaaa gtttttgaca gtgaagtcat aataattaca acaaaccttg ccaatccagc
     1801 cccacttgat tatgtcaact ttgaggcctg ttccaggaga attgatttcc tggtgtacgc
     1861 tgaggcacca gaagtagaaa aggcaaagcg ggactttcct ggtcaaccag atatgtggaa
     1921 ggacgccttc aagtcggact tttcacacat caagctacag cttgcacctc agggcggctt
     1981 tgacaagaat ggcaacaccc cacatgggaa aggagtgatg aagaccctca ctaccggttc
     2041 tctgattgcc cgtgcatcag gcctactgca tgagaggatg gatgaatttg aactccaagg
     2101 tcccacaatc accaccttca atttcgaccg gaacagaatc acagcattca gacaattggc
     2161 tgcagaaaac aagtatggat tggtggacac catgaaagtt ggcaatcaac taaaaggagt
     2221 gaaaaccatg gaagaactca aacaagcaat caggaatgtg accatcaaaa ggtgccggat
     2281 catctacggt ggctccacgt atgaccttga atctgatggc aagggcaaag ttttggtgga
     2341 aaaggtcaag aacacctctg tgcagaccaa caacgagtta gccggggccc tgcaccatct
     2401 caaacacgcc cgaatcaggt actatgtcaa atgtgtgcaa gaagcagtct attccattat
     2461 acaaattgcc ggcgctgcgt ttgtcaccac gcgcattgca cgccgcatga acatacaaga
     2521 actctggtcg aagccacaat tagatcaaaa tgaatcagag actaaggaag aggcccccaa
     2581 gtcagaagat gacgagttca tcatatcttc taaggacatc aaggaggaag gaaagaaggg
     2641 caaaaacaaa actggccgtg gcaagaaaca cactgcattc tccagcaagg gcttgagcga
     2701 tgaggagtat gacgagtaca agaggataag agaagagaga aatgggaagt actctataga
     2761 ggagtatctt caagacagag ataggtacta tgaggagctc gccattgcca aggctacgga
     2821 agaagacttc tgtgaagagg aggagatcaa aatccgtcag agaattttcc gtcccaccag
     2881 gaaacaaaga aaggaagaga gggccacatt agggctagta acaggttcag aaatcagaaa
     2941 aagaaaccct gatgacttca aacccaaagg gaagctgtgg gccgatgaca acagaagtgt
     3001 tgactacaat gagaaactgg actttgaggc ccccccaagc atatggtcta ggattgtgag
     3061 ctttggttct ggctggggct tctgggtatc accaagccta ttcataacat caactcatgt
     3121 gatccccgca ggcataacag aagcatttgg agtccccatc aaacaaattc agatccacaa
     3181 atcaggtgaa ttttgccgat tcagattccc aaagccaatt agaccagatg tgacaggaat
     3241 gatcttagaa gaaggtgcgc ctgaaggcac cgtggcaact gtgctcatca aacgccccac
     3301 cggagagctc atgcctcttg cagccagaat ggggacacac gcaaccatga aaattcaagg
     3361 ccgcatggtt ggcggacaga tgggtatgtt gctcactggg tcaaatgcta aaggaatgga
     3421 tttgggaaca actcctggtg actgtggctg tccttacatc tataaaaggg gcaatgacta
     3481 tatagtcatt ggggtgcaca ctgcagcagc ccgtggtgga aacaccgtca tctgtgccac
     3541 acagggaagt gagggtgagg caactcttga gggtggagat gacaaaggaa catactgtgg
     3601 ggcacccatt ctaggccctg ggggtgcacc aaaattgagc accaaaacca aattttggag
     3661 gtcatcgaac acgccccttc caccaggaac atatgagcct gcctacctcg gtggccgtga
     3721 tccgcgtgtt aagggtgggc cctccttgca gcaggtaatg agagaccagt tgaagccatt
     3781 cactgaaccc aggggcaaac ccccaagacc aagtgtattg gaagcagcca aacaaaccat
     3841 tatcaatgtc ctcgaacaaa ccctggaccc tccacaaaaa tggacatacg cacaggcgtg
     3901 tgcctcactt gacaaaacca cctccagcgg gcacccccat cacgtccgaa agaatgaatt
     3961 ctggaatggt gagaccttca ctggtaaatt ggcagaccaa gcatcaaaag caaacctaat
     4021 gtttgaggag gggaaacaca tgacaccagt gtatacagca gcactcaagg acgagctagt
     4081 caagaccgag aaaatctatg gaaagatcaa gaagagactg ctctggggct ctgacttgtc
     4141 caccatgatc cggtgcgcta ggtcatttgg tgggctcatg gacgagatga aggcacactg
     4201 catatcactc ccagtacgag ttggcatgaa tatgaatgaa gatggcccaa taatatttga
     4261 gaaacattcc agatataaat atcactatga tgcagactac tctcgttggg attcaacaca
     4321 acagagggca gtactagcag cagccttgga aatcatggtc agattctctg cagaaccaca
     4381 attggcacaa atagtcgctg aggatctgct ggcccctagt gtagtagatg taggagactt
     4441 taaaatcaca ataaatgaag ggctcccatc tggtgtgcca tgcacttctc aatggaactc
     4501 catcgcacac tggctgctaa ctctctgcgc cttgtctgag gtcaccaaac tgtcccctga
     4561 cattatacag gcaaattcca tgttctcatt ttacggtgat gacgagattg tcagcaccga
     4621 tataaaattg gaccctgaac agttaaccgc caagttgaag gagtacggcc tgaaaccaac
     4681 ccgcccagac aagaccgagg gacccctgat catcagtgaa gatttaaacg gactcacttt
     4741 cctccgaagg acggtgactc gtgacccagc tggttggttt ggaaagctgg accaaagctc
     4801 aattttgagg cagatgtact ggactagagg accaaatcat gaagacccca atgagacaat
     4861 gataccccat tcccaaagac ccatacagct catggcactg cttggtgaag cctctcttca
     4921 cggaccctct ttctacagta aaattagtaa attggtcata actgaactca aagaaggtgg
     4981 gatggacttt tacgtgccaa ggcaggaacc catgttcagg tggatgaggt tttctgactt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccaatttt gtgaatgaag atggcgtcga
     5101 atgacgccac cccatctaat gatggtgccg ccggcctcgt cccagagatc aacaatgagg
     5161 caatggcgct agatccagtg gcgggtgcag cgatagcagc acccctcacc ggccagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagttcacag
     5281 tgtctcctag gaattcccct ggtgaagtgc tcctcaattt ggaattgggc ccagagataa
     5341 acccctatct ggcccatctt gctagaatgt ataatggtta tgcaggtgga tttgaagtgc
     5401 aggtagtcct ggctggaaat gcgtttacag caggaaagat aatctttgca gctatacccc
     5461 ctaacttccc aattgacaat ctaagtgcag cacagatcac aatgtgccca catgtgattg
     5521 tggatgtcag gcaactggaa ccagtcaacc tcccgatgcc tgacgttcgc aataacttct
     5581 tccactacaa ccaagggtct gattcgaaat tgcgcctgat tgcaatgctg tatacacctc
     5641 ttagggcaaa taactctggg gatgatgttt tcactgtgtc ttgtagagtg ctgactagac
     5701 ctagtcctga attttcattt aacttccttg tgccacccac tgtggagtca aagacaaaac
     5761 cttttaccct cccaattctg actatctctg aaatgtctaa ttctaggttt ccagtgccga
     5821 ttgattctct gcacaccagc ccaactgaga atattgttgt ccagtgtcaa aatggacgcg
     5881 tcactcttga tggcgagttg atgggcacca ctcagctctt acctagtcaa atctgtgctt
     5941 tcaggggcgt gctcactagg tcaacaagca gggctagtga ccaggccgac acagcaaccc
     6001 ctagattgtt taattattat tggcacatac aattggataa tctaaatggg actccttatg
     6061 atcctgcaga agacatacca ggccccctag ggacaccaga ttttcggggt aaagtctttg
     6121 gcgtggccag ccaaagaaac cccgacagta caactagagc acatgaagca aaggtggaca
     6181 caacagctgg tcgcttcacc ccaaaactag gctcattaga gatatccact gaatctggcg
     6241 actttgacca aaaccaacca acaagattca ccccagttgg cattggggtt gaccaagagt
     6301 cagacttcca gcaatggtcc ttacccgatt actctggcca gttcactcac aacatgaact
     6361 tggccccagc tgttgctccc aacttccctg gtgagcagct ccttttcttc cgctcacagt
     6421 taccatcttc tggtgggcga tccaatggga ttctagattg cctggtcccc caagaatggg
     6481 tccagcactt ctaccaagaa tcagcccccg cccaaaccca ggtggctctg gttagatatg
     6541 tcaaccctga cactggtaga gtgttgtttg aggccaagct gcacaaatta ggtttcatga
     6601 ctatagctaa gaatggtgac tctccaataa ctgtccctcc aaatggatac tttaggtttg
     6661 aatcttgggt gaacccattt tacacacttg cccccatggg aactgggaat gggcgtagaa
     6721 gagttcaata atggctggtg cttttgtagc aggattagct ggtgatatac tcacaaatac
     6781 tgtagggtct ctagttaatg caggggctaa tgctattaat caaaaagttg attttgaaaa
     6841 taataaatat ttgcaaaatg cttccttcaa tcatgataag gaaatgttaa atgcacagat
     6901 tgaggcaaca aagagattac aggctgatat gattgctatc aaacaggggg ttttgaccgc
     6961 tggcggcttt tcccccactg atgcagctcg cggggcaatc aacgccccca tgacaaaagt
     7021 cctagattgg aatggaacaa ggtactgggc accaagtgcc acctctacaa cctcgatgtc
     7081 gggtggcttc acaaaccagg ctgtgcacag gaccacgcca aattttaaaa tgaaccaggc
     7141 ccccagatcc acacccagca gtgggtcttc agtgaggtca ctctcaaccc aaatcactag
     7201 tctgagctca cactcgtccg ggtcgtctcg atccagcgga tctacagttg ctagctcact
     7261 accatcctct aacaggacta gggactgggt caatcagcaa aattttaatt tggaaccaca
     7321 catgcctggg tcacttagga cggcttttgt cactccacca tctagtacag cctctagttc
     7381 aggcactgtc tcaaccgtgc ccaaaaatgt tttggactcc tggacatctg cgtttaacac
     7441 gcgcagacag ccgctcttcg cacaccttcg tagaaggggg gagtcaaatg tttagtgaaa
     7501 aggttatctt aaatttgatt taaattgaat ttgatttgga atcttttaaa aaaaaaaaaa
     7561 aaaaaaaa
//